UniProt ID | PSA1_DROME | |
---|---|---|
UniProt AC | P12881 | |
Protein Name | Proteasome subunit alpha type-1 | |
Gene Name | Prosalpha6 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 279 | |
Subcellular Localization | Cytoplasm. Nucleus. | |
Protein Description | The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.. | |
Protein Sequence | MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVLVALCKPTSELSDTQRKIIPIDDHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVGLLVAGYDERGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGIRAILGTLPTDEQGKDAGQYDITVAIVGKDQPFTILSNKDSAKHVAIAKENDNDTPRNDDDDDRPSPPEEPAAGPRDPEVLVATEQRP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | Phosphorylation | DSDVTVWSPQGRLHQ CCCCEEECCCCCCHH | 11.74 | 30478224 | |
103 | Phosphorylation | KHSYDTTYPVSRLIT CCCCCCCCCHHHHHH | 12.06 | - | |
174 | Acetylation | SARTYLEKNLNKFLD HHHHHHHHHHHHHHH | 65.23 | 21791702 | |
178 | Acetylation | YLEKNLNKFLDSSKD HHHHHHHHHHHCCHH | 50.93 | 21791702 | |
184 | Acetylation | NKFLDSSKDEIIRHG HHHHHCCHHHHHHHH | 64.43 | 21791702 | |
246 | Phosphorylation | AKENDNDTPRNDDDD EEECCCCCCCCCCCC | 30.33 | 22668510 | |
257 | Phosphorylation | DDDDDRPSPPEEPAA CCCCCCCCCCCCCCC | 54.72 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSA1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSA1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSA1_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PSA4_DROME | Prosalpha3 | physical | 22036573 | |
TERA_DROME | TER94 | physical | 22036573 | |
PSMF1_DROME | PI31 | physical | 23622245 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...