UniProt ID | NACA_DROME | |
---|---|---|
UniProt AC | Q94518 | |
Protein Name | Nascent polypeptide-associated complex subunit alpha | |
Gene Name | Nacalpha | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 217 | |
Subcellular Localization | ||
Protein Description | May promote appropriate targeting of ribosome-nascent polypeptide complexes (By similarity). Required for correct localization of the osk/oskar protein to the posterior pole during embryonic development. The osk protein directs the recruitment of molecules responsible for posterior body patterning and germline formation in the embryo.. | |
Protein Sequence | MPELTEIKSEAAPSTSAEAKPEDVRVEDDGSDSDSDGGMPGLEEAVAATTQLGGGATGLPIDLVSKAKQSRGEKKARKIMLKLGLKQIQGVNRVTIRKSKNILFVINNPDVYKNPHSDTYIVFGEAKIEDLSQQAQVAAAEKFKAPEAAGAADSVGATTSVAPIAEEDEEDVDDTGVDEKDIELVITQANTTRAKAIKALKNNNNDIVNAIMELTML | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | PELTEIKSEAAPSTS CCHHHCCCCCCCCCC | 37.82 | 19429919 | |
14 | Phosphorylation | IKSEAAPSTSAEAKP CCCCCCCCCCCCCCH | 30.21 | 19429919 | |
15 | Phosphorylation | KSEAAPSTSAEAKPE CCCCCCCCCCCCCHH | 30.78 | 19429919 | |
16 | Phosphorylation | SEAAPSTSAEAKPED CCCCCCCCCCCCHHC | 28.57 | 19429919 | |
31 | Phosphorylation | VRVEDDGSDSDSDGG CCCCCCCCCCCCCCC | 40.72 | 19429919 | |
33 | Phosphorylation | VEDDGSDSDSDGGMP CCCCCCCCCCCCCCC | 40.48 | 19429919 | |
35 | Phosphorylation | DDGSDSDSDGGMPGL CCCCCCCCCCCCCCH | 41.95 | 19429919 | |
99 | Phosphorylation | NRVTIRKSKNILFVI CEEEEECCCCEEEEE | 22.53 | 21082442 | |
117 | Phosphorylation | DVYKNPHSDTYIVFG CHHCCCCCCCEEEEC | 32.67 | 22817900 | |
119 | Phosphorylation | YKNPHSDTYIVFGEA HCCCCCCCEEEECEE | 20.40 | 22817900 | |
142 | Acetylation | AQVAAAEKFKAPEAA HHHHHHHHCCCHHHH | 47.65 | 21791702 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NACA_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NACA_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NACA_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TERA_DROME | TER94 | physical | 22036573 | |
RS10B_DROME | RpS10b | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...