NACA_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NACA_DROME
• UniProt AC: Q94518
• Protein Name: Nascent polypeptide-associated complex subunit alpha
• Gene Name: Nacalpha
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 217
• Protein Description: May promote appropriate targeting of ribosome-nascent polypeptide complexes (By similarity). Required for correct localization of the osk/oskar protein to the posterior pole during embryonic development. The osk protein directs the recruitment of molecules responsible for posterior body patterning and germline formation in the embryo..
• Protein Sequence: MPELTEIKSEAAPSTSAEAKPEDVRVEDDGSDSDSDGGMPGLEEAVAATTQLGGGATGLPIDLVSKAKQSRGEKKARKIMLKLGLKQIQGVNRVTIRKSKNILFVINNPDVYKNPHSDTYIVFGEAKIEDLSQQAQVAAAEKFKAPEAAGAADSVGATTSVAPIAEEDEEDVDDTGVDEKDIELVITQANTTRAKAIKALKNNNNDIVNAIMELTML

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
9	Phosphorylation	PELTEIKSEAAPSTS CCHHHCCCCCCCCCC	37.82	19429919
14	Phosphorylation	IKSEAAPSTSAEAKP CCCCCCCCCCCCCCH	30.21	19429919
15	Phosphorylation	KSEAAPSTSAEAKPE CCCCCCCCCCCCCHH	30.78	19429919
16	Phosphorylation	SEAAPSTSAEAKPED CCCCCCCCCCCCHHC	28.57	19429919
31	Phosphorylation	VRVEDDGSDSDSDGG CCCCCCCCCCCCCCC	40.72	19429919
33	Phosphorylation	VEDDGSDSDSDGGMP CCCCCCCCCCCCCCC	40.48	19429919
35	Phosphorylation	DDGSDSDSDGGMPGL CCCCCCCCCCCCCCH	41.95	19429919
99	Phosphorylation	NRVTIRKSKNILFVI CEEEEECCCCEEEEE	22.53	21082442
117	Phosphorylation	DVYKNPHSDTYIVFG CHHCCCCCCCEEEEC	32.67	22817900
119	Phosphorylation	YKNPHSDTYIVFGEA HCCCCCCCEEEECEE	20.40	22817900
142	Acetylation	AQVAAAEKFKAPEAA HHHHHHHHCCCHHHH	47.65	21791702

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NACA_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NACA_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NACA_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TERA_DROME	TER94	physical	22036573
RS10B_DROME	RpS10b	physical	22036573

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.