| UniProt ID | RAS2_DROME | |
|---|---|---|
| UniProt AC | P04388 | |
| Protein Name | Ras-like protein 2 | |
| Gene Name | Ras64B | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 192 | |
| Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
| Protein Description | May be involved in endocytic processes and/or other transport pathways mediated by vesicle trafficking. May interact functionally with ROP protein. Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.. | |
| Protein Sequence | MQMQTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFSAMREQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEEAQNTSRNLMIPYIECSAKLRVNVDQAFHELVRIVRKFQIAERPFIEQDYKKKGKRKCCLM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 46 | S-palmitoylation | EDSYTKQCNIDDVPA CHHCCCCCCCCCCCC | 5.27 | 30735487 | |
| 120 | S-palmitoylation | MLMVGNKCDLKHQQQ EEEECCCCCCCCHHH | 9.57 | 30735487 | |
| 147 | S-palmitoylation | LMIPYIECSAKLRVN CCEEEEEEEEEEECC | 3.30 | 30735487 | |
| 189 | Methylation | KKKGKRKCCLM---- HHCCCCCCCCC---- | 2.21 | - | |
| 189 | Farnesylation | KKKGKRKCCLM---- HHCCCCCCCCC---- | 2.21 | - | |
| 189 | S-palmitoylation | KKKGKRKCCLM---- HHCCCCCCCCC---- | 2.21 | 30735487 | |
| 190 | S-palmitoylation | KKGKRKCCLM----- HCCCCCCCCC----- | 3.98 | 30735487 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAS2_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAS2_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAS2_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| DECA_DROME | dpp | genetic | 9056776 | |
| SPY_DROME | sty | genetic | 12932331 | |
| GIL_DROME | aos | genetic | 12932331 | |
| RAS1_DROME | Ras85D | genetic | 12932331 | |
| SPRI_DROME | spri | physical | 16054027 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
