UniProt ID | RHEB_DROME | |
---|---|---|
UniProt AC | Q9VND8 | |
Protein Name | GTP-binding protein Rheb homolog | |
Gene Name | Rheb | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 182 | |
Subcellular Localization |
Endomembrane system Lipid-anchor Cytoplasmic side . Golgi apparatus membrane Lipid-anchor Cytoplasmic side . Cytoplasm, cytosol . Endoplasmic reticulum membrane Lipid-anchor Cytoplasmic side . |
|
Protein Description | Binds GTP and exhibits intrinsic GTPase activity (By similarity). Activates the protein kinase activity of TORC1, and thereby plays a role in the regulation of apoptosis. [PubMed: 22493059 Stimulates the phosphorylation of S6K through activation of TORC1 signaling] | |
Protein Sequence | MPTKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSIFPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEGKKLAESWRAAFLETSAKQNESVGDIFHQLLILIENENGNPQEKSGCLVS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RHEB_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RHEB_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RHEB_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...