UniProt ID | RL17_DROME | |
---|---|---|
UniProt AC | Q9W3W8 | |
Protein Name | 60S ribosomal protein L17 | |
Gene Name | RpL17 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 186 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MGRYSRESDNVAKSCKARGPNLRVHFKNTHETAQAIKRMPLRRAQRYLKAVIDQKECVPFRRFNGGVGRCAQAKQWKTTQGRWPKKSAEFLLQLLRNAEANADCKGLDADRLVVHHIQVNRAQCLRRRTYRAHGRINPYMSSPCHVEVILTEKEELVSKATDDEPAKKKLSKKKLQRQKEKMLRSE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MGRYSRESDNV ----CCCCCCCHHHH | 13.32 | 19429919 | |
5 | Phosphorylation | ---MGRYSRESDNVA ---CCCCCCCHHHHH | 28.36 | 19429919 | |
8 | Phosphorylation | MGRYSRESDNVAKSC CCCCCCCHHHHHHHH | 33.12 | 19429919 | |
37 | Acetylation | HETAQAIKRMPLRRA HHHHHHHHHCHHHHH | 45.73 | 21791702 | |
142 | Phosphorylation | RINPYMSSPCHVEVI CCCCCCCCCCEEEEE | 18.28 | 21082442 | |
158 | Phosphorylation | TEKEELVSKATDDEP CCHHHHHHHCCCCHH | 29.24 | 22817900 | |
159 | Acetylation | EKEELVSKATDDEPA CHHHHHHHCCCCHHH | 48.07 | 21791702 | |
161 | Phosphorylation | EELVSKATDDEPAKK HHHHHHCCCCHHHHH | 47.95 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL17_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL17_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL17_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DORS_DROME | dl | physical | 14605208 | |
DIMM_DROME | dimm | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-158 AND THR-161, ANDMASS SPECTROMETRY. |