DDX17_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DDX17_DROME
• UniProt AC: P19109
• Protein Name: ATP-dependent RNA helicase p62
• Gene Name: Rm62
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 719
• Subcellular Localization: Nucleus . Nucleus, nucleolus . Cytoplasm, cytosol . In the course of bunyavirus infection, relocalizes from the nucleus to the cytosol where it binds viral RNA to antagonize replication.
• Protein Description: As an RNA helicase, unwinds RNA and alters RNA structures through ATP binding and hydrolysis. Involved in multiple cellular processes, including pre-mRNA splicing, alternative splicing, rRNA processing and miRNA processing, as well as transcription regulation (By similarity). [PubMed: 12368261 Plays a role in innate immunity. Specifically restricts bunyavirus infection, including Rift Valley fever virus (RVFV) or La Crosse virus (LACV), but not vesicular stomatitis virus (VSV), in an interferon- and DROSHA-independent manner]
• Protein Sequence: MLKLVQYIAPRVGGATPRPTACGWGNLLLISPRSGASSEKCITQRRHFLFSSASSSGTFASSSSLCTEQRQQFHGSRRNRETILFPSTYSSLQAQSQRAFRDSSKPDSDDYVDSIPKAEQRTRTRKSLFNDPDERTEEIKIEGVMAPHDRDFGHSGRGGRGGDRGGDDRRGGGGGGNRFGGGGGGGDYHGIRNGRVEKRRDDRGGGNRFGGGGGFGDRRGGGGGGSQDLPMRPVDFSNLAPFKKNFYQEHPNVANRSPYEVQRYREEQEITVRGQVPNPIQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLARNSRYDGGGGRSRYGGGGGGGRFGGGGFKKGSLSNGRGFGGGGGGGGEGRHSRFD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
226	Phosphorylation	RGGGGGGSQDLPMRP CCCCCCCCCCCCCCC	24.64	19429919
257	Phosphorylation	HPNVANRSPYEVQRY CCCCCCCCHHHHHHH	31.47	29892262
581	Phosphorylation	REFRSGKSNILVATD HHHHCCCCCEEEEEH	32.40	22817900
627	Acetylation	RTGRSNTKGTSFAFF CCCCCCCCCCCEEEE	65.52	21791702
636	Acetylation	TSFAFFTKNNAKQAK CCEEEEECCCHHHHH	42.94	21791702
696	Phosphorylation	GGGFKKGSLSNGRGF CCCCCCCCCCCCCCC	37.19	29892262
716	Phosphorylation	GGGEGRHSRFD---- CCCCCCCCCCC----	33.03	21082442

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DDX17_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DDX17_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DDX17_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NUMB_DROME	numb	physical	14605208
LTOR3_DROME	CG5110	physical	14605208
DDX17_DROME	Rm62	physical	14605208
NPLP1_DROME	Nplp1	physical	14605208
BX42_DROME	Bx42	physical	14605208
EXOC2_DROME	Sec5	physical	14605208
ANX11_DROME	AnxB11	physical	14605208
FMR1_DROME	Fmr1	physical	12368261
AGO2_DROME	AGO2	physical	12368261
DDX17_DROME	Rm62	physical	21674064
SUV39_DROME	Su(var)3-9	physical	21674064

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.