UniProt ID | NPLP1_DROME | |
---|---|---|
UniProt AC | Q9W0W6 | |
Protein Name | Neuropeptide-like 1 | |
Gene Name | Nplp1 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 309 | |
Subcellular Localization | Secreted. | |
Protein Description | NPLP1-4: Acts as a ligand for the receptor-type guanylate cyclase Gyc76C. [PubMed: 21893139 Stimulates Gyc76c-dependent cGMP production and modulates the IMD innate immune pathway in response to salt stress by inducing nuclear translocation of NF-kappa-B protein Rel which leads to increased expression of the antimicrobial peptide diptericin] | |
Protein Sequence | MQAVLQSAHSSRRLMLLLSMLLNAAIQPRSIIVSATDDVANVSPCEMESLINQLMSPSPEYQLHASALRNQLKNLLRERQLAVGEEQPLGEYPDYLEEDKRSVAALAAQGLLNAPKRSLATLAKNGQLPTAEPGEDYGDADSGEPSEQKRYIGSLARAGGLMTYGKRNVGTLARDFQLPIPNGKRNIATMARLQSAPSTHRDPKRNVAAVARYNSQHGHIQRAGAEKRNLGALKSSPVHGVQQKREDEEMLLPAAAPDYADPMQSYWWYPSYAGYADLDWNDYRRAEKRFLGRVLPPTRATASTHRSRL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
142 | Phosphorylation | EDYGDADSGEPSEQK CCCCCCCCCCCCHHH | 46.94 | 27794539 | |
164 | Tyrosine amide | RAGGLMTYGKRNVGT HHCCCCCCCCCCHHH | 13.49 | - | |
164 | Amidation | RAGGLMTYGKRNVGT HHCCCCCCCCCCHHH | 13.49 | 12171930 | |
182 | Asparagine amide | DFQLPIPNGKRNIAT HCCCCCCCCCCCHHH | 70.14 | - | |
182 | Amidation | DFQLPIPNGKRNIAT HCCCCCCCCCCCHHH | 70.14 | 12171930 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NPLP1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NPLP1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NPLP1_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CNN_DROME | cnn | physical | 14605208 | |
MYSP1_DROME | Prm | physical | 14605208 | |
MYSP2_DROME | Prm | physical | 14605208 | |
TFP11_DROME | sip1 | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...