UniProt ID | SQH_DROME | |
---|---|---|
UniProt AC | P40423 | |
Protein Name | Myosin regulatory light chain sqh | |
Gene Name | sqh | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 174 | |
Subcellular Localization | ||
Protein Description | Required for cytokinesis, could regulate contractile ring function.. | |
Protein Sequence | MSSRKTAGRRATTKKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGKNPTDDYLDGMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELLTTMGDRFTDEDVDEMYREAPIKNGLFDYLEFTRILKHGAKDKDEQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
21 | Phosphorylation | KKRAQRATSNVFAMF HHHHHHHHHHHHHHC | 24.03 | 19429919 | |
22 | Phosphorylation | KRAQRATSNVFAMFD HHHHHHHHHHHHHCC | 29.97 | 9412474 | |
157 | Phosphorylation | IKNGLFDYLEFTRIL CCCCCCHHHHHHHHH | 10.78 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
22 | S | Phosphorylation | Kinase | PAK-SUBFAMILY | - | GPS |
22 | S | Phosphorylation | Kinase | PAK | - | PhosphoELM |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SQH_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SQH_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PICO_DROME | Picot | physical | 22036573 | |
ROP_DROME | Rop | physical | 22036573 | |
OVO_DROME | ovo | genetic | 17656094 | |
PKN_DROME | Pkn | genetic | 25131196 | |
MYSN_DROME | zip | genetic | 20553709 | |
PATJ_DROME | Patj | physical | 23128243 | |
PP1B_DROME | flw | physical | 15269282 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-21 AND SER-22, AND MASSSPECTROMETRY. | |
"An integrated chemical, mass spectrometric and computational strategyfor (quantitative) phosphoproteomics: application to Drosophilamelanogaster Kc167 cells."; Bodenmiller B., Mueller L.N., Pedrioli P.G.A., Pflieger D.,Juenger M.A., Eng J.K., Aebersold R., Tao W.A.; Mol. Biosyst. 3:275-286(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-21 AND SER-22, AND MASSSPECTROMETRY. |