dbPTM

PP1B_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PP1B_DROME
UniProt AC	P48462
Protein Name	Serine/threonine-protein phosphatase beta isoform
Gene Name	flw
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	330
Subcellular Localization
Protein Description	Required for cell adhesion in non-muscle tissues and in maintenance of muscle attachment. Vital for larval development..
Protein Sequence	MGDFDLNVDSLIQRLLEMRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVDDTLMCSFQILKPSEKKAKYLYSGMNSSRPTTPQRSAPMLATNKKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
304	Phosphorylation	PSEKKAKYLYSGMNS CCHHHHHHHHCCCCC	18.74	18281928
306	Phosphorylation	EKKAKYLYSGMNSSR HHHHHHHHCCCCCCC	10.49	18281928
311	Phosphorylation	YLYSGMNSSRPTTPQ HHHCCCCCCCCCCCC	20.87	19429919
312	Phosphorylation	LYSGMNSSRPTTPQR HHCCCCCCCCCCCCC	36.96	19429919
315	Phosphorylation	GMNSSRPTTPQRSAP CCCCCCCCCCCCCCC	50.42	19429919
316	Phosphorylation	MNSSRPTTPQRSAPM CCCCCCCCCCCCCCC	21.80	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PP1B_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PP1B_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PP1B_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CBPD_DROME	svr	physical	14605208
BAP60_DROME	Bap60	physical	14605208
CP306_DROME	phm	physical	14605208
RS8_DROME	RpS8	physical	14605208
LCP2A_DROME	Cpr47Eg	physical	14605208
PP12_DROME	Pp1-87B	physical	22036573
POE_DROME	poe	physical	21447707
KP58_DROME	Pitslre	physical	21447707
SGF11_DROME	Sgf11	physical	21447707
MED12_DROME	kto	physical	21447707
OSM1_DROME	Oseg2	physical	21447707
MYSN_DROME	zip	physical	21447707
ITPR_DROME	Itp-r83A	physical	21447707
ABL_DROME	Abl	physical	21447707
MYSA_DROME	Mhc	physical	21447707
XDH_DROME	ry	physical	21447707
PP12_DROME	Pp1-87B	physical	21447707
SOS_DROME	Sos	physical	21447707
SYEP_DROME	Aats-glupro	physical	21447707
TNNI_DROME	wupA	physical	21447707
SQH_DROME	sqh	physical	21447707
TRPL_DROME	trpl	physical	21447707
PROML_DROME	prominin-like	physical	21447707
CAZ_DROME	caz	physical	21447707
VATA2_DROME	Vha68-2	physical	21447707
TRA1_DROME	Nipped-A	physical	21447707
RS8_DROME	RpS8	physical	21447707
Y5521_DROME	CG5521	physical	21447707
CAD89_DROME	Cad89D	physical	21447707
NOTCH_DROME	N	genetic	21490061
SQH_DROME	sqh	genetic	15269282
DAPKR_DROME	Drak	genetic	20573980
RHO1_DROME	Rho1	genetic	15269282
RHO1_DROME	Rho1	genetic	21490061
MYSN_DROME	zip	genetic	15269282
MYSN_DROME	zip	genetic	21490061
TPM1_DROME	Tm1	genetic	15269282
TPM4_DROME	Tm1	genetic	15269282
JNK_DROME	bsk	genetic	17277363
SQH_DROME	sqh	physical	15269282
MERH_DROME	Mer	physical	22133918
KTU_DROME	Nop17l	physical	17007873
MARS_DROME	mars	physical	17007873
GBS76_DROME	Gbs-76A	physical	17007873
TRX_DROME	trx	physical	17007873

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PP1B_DROME

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-315 AND THR-316, ANDMASS SPECTROMETRY.	18327897 [Abstract]