UniProt ID | PP1B_DROME | |
---|---|---|
UniProt AC | P48462 | |
Protein Name | Serine/threonine-protein phosphatase beta isoform | |
Gene Name | flw | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 330 | |
Subcellular Localization | ||
Protein Description | Required for cell adhesion in non-muscle tissues and in maintenance of muscle attachment. Vital for larval development.. | |
Protein Sequence | MGDFDLNVDSLIQRLLEMRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVDDTLMCSFQILKPSEKKAKYLYSGMNSSRPTTPQRSAPMLATNKKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
304 | Phosphorylation | PSEKKAKYLYSGMNS CCHHHHHHHHCCCCC | 18.74 | 18281928 | |
306 | Phosphorylation | EKKAKYLYSGMNSSR HHHHHHHHCCCCCCC | 10.49 | 18281928 | |
311 | Phosphorylation | YLYSGMNSSRPTTPQ HHHCCCCCCCCCCCC | 20.87 | 19429919 | |
312 | Phosphorylation | LYSGMNSSRPTTPQR HHCCCCCCCCCCCCC | 36.96 | 19429919 | |
315 | Phosphorylation | GMNSSRPTTPQRSAP CCCCCCCCCCCCCCC | 50.42 | 19429919 | |
316 | Phosphorylation | MNSSRPTTPQRSAPM CCCCCCCCCCCCCCC | 21.80 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PP1B_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PP1B_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PP1B_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-315 AND THR-316, ANDMASS SPECTROMETRY. |