TNNI_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TNNI_DROME
• UniProt AC: P36188
• Protein Name: Troponin I
• Gene Name: wupA
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 269
• Protein Description: Troponin I is the ATPase inhibitory subunit of troponin in the thin filament regulatory complex. Involved in the development and maintenance of muscle and nervous system. May also be involved in the cytoskeletal apparatus..
• Protein Sequence: MADDEKKAAAPAAAPAAAAKPAAPAAAPAANGKAAPAANGKAAPAAAAAPAGPPKDPNDPKVKAEEAKKAKQAEIERKRAEVRKRMEEASKAKKAKKGFMTPERKKKLRLLLRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASEGELQEICEEYYERMYICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALKKVSKYENKFAKLQKKAAEFNFRNQLKVVKKKEFTLEEEEKEKKPDWSKGKPGDAKVKEEVEAEA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MADDEKKAA ------CCHHHHHHH	32.72	-
85 (in isoform 8)	Phosphorylation	-	27.47	28490779
85 (in isoform 3)	Phosphorylation	-	27.47	28490779
85 (in isoform 2)	Phosphorylation	-	27.47	28490779
85 (in isoform 9)	Phosphorylation	-	27.47	28490779
88 (in isoform 8)	Phosphorylation	-	49.23	28490779
88 (in isoform 9)	Phosphorylation	-	49.23	28490779
105 (in isoform 9)	Phosphorylation	-	53.23	27794539
105 (in isoform 8)	Phosphorylation	-	53.23	27794539
146	Phosphorylation	CGSPRNLSDASEGEL HCCCCCCCCCCHHHH	34.38	28490779
149	Phosphorylation	PRNLSDASEGELQEI CCCCCCCCHHHHHHH	51.64	28490779
178 (in isoform 2)	Phosphorylation	-	12.15	27794539
178 (in isoform 4)	Phosphorylation	-	12.15	27794539
178 (in isoform 6)	Phosphorylation	-	12.15	27794539
178 (in isoform 8)	Phosphorylation	-	12.15	27794539
201	Methylation	DLRGKFVKPALKKVS HHCCCCHHHHHHHHH	27.92	-
201	"N6,N6,N6-trimethyllysine"	DLRGKFVKPALKKVS HHCCCCHHHHHHHHH	27.92	-
205	"N6,N6,N6-trimethyllysine"	KFVKPALKKVSKYEN CCHHHHHHHHHHHHH	53.92	-
205	Methylation	KFVKPALKKVSKYEN CCHHHHHHHHHHHHH	53.92	-
208	Phosphorylation	KPALKKVSKYENKFA HHHHHHHHHHHHHHH	38.10	27794539
239 (in isoform 10)	Phosphorylation	-	34.06	27794539
239	Phosphorylation	VVKKKEFTLEEEEKE HEEECCCCCCHHHHH	34.06	27794539

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TNNI_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TNNI_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TNNI_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GBB2_DROME	Gbeta76C	physical	14605208
TNNC2_DROME	TpnC47D	physical	14605208
RL22_DROME	RpL22	physical	14605208
TPM2_DROME	Tm2	physical	22036573
TNNT_DROME	up	physical	22036573
MYSA_DROME	Mhc	physical	22036573
TNNC1_DROME	TpnC41C	physical	22036573
AT5F1_DROME	ATPsyn-b	physical	22036573
ATP5J_DROME	ATPsyn-Cf6	physical	22036573
ATPK_DROME	CG4692	physical	22036573
ICLN_DROME	icln	physical	22036573
ATPO_DROME	Oscp	physical	22036573
GSTS1_DROME	GstS1	physical	22036573
FTN_DROME	fln	physical	22036573
MYSA_DROME	Mhc	genetic	10085296
MYSA_DROME	Mhc	genetic	12750333
MYSA_DROME	Mhc	genetic	14718563
MYSA_DROME	Mhc	genetic	25747460
TPM2_DROME	Tm2	genetic	11359941
ATC1_DROME	Ca-P60A	genetic	24098595
CISY_DROME	kdn	physical	22036573
ORB2_DROME	orb2	physical	26638074

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.