UniProt ID | TNNI_DROME | |
---|---|---|
UniProt AC | P36188 | |
Protein Name | Troponin I | |
Gene Name | wupA | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 269 | |
Subcellular Localization | ||
Protein Description | Troponin I is the ATPase inhibitory subunit of troponin in the thin filament regulatory complex. Involved in the development and maintenance of muscle and nervous system. May also be involved in the cytoskeletal apparatus.. | |
Protein Sequence | MADDEKKAAAPAAAPAAAAKPAAPAAAPAANGKAAPAANGKAAPAAAAAPAGPPKDPNDPKVKAEEAKKAKQAEIERKRAEVRKRMEEASKAKKAKKGFMTPERKKKLRLLLRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASEGELQEICEEYYERMYICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALKKVSKYENKFAKLQKKAAEFNFRNQLKVVKKKEFTLEEEEKEKKPDWSKGKPGDAKVKEEVEAEA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MADDEKKAA ------CCHHHHHHH | 32.72 | - | |
85 (in isoform 8) | Phosphorylation | - | 27.47 | 28490779 | |
85 (in isoform 3) | Phosphorylation | - | 27.47 | 28490779 | |
85 (in isoform 2) | Phosphorylation | - | 27.47 | 28490779 | |
85 (in isoform 9) | Phosphorylation | - | 27.47 | 28490779 | |
88 (in isoform 8) | Phosphorylation | - | 49.23 | 28490779 | |
88 (in isoform 9) | Phosphorylation | - | 49.23 | 28490779 | |
105 (in isoform 9) | Phosphorylation | - | 53.23 | 27794539 | |
105 (in isoform 8) | Phosphorylation | - | 53.23 | 27794539 | |
146 | Phosphorylation | CGSPRNLSDASEGEL HCCCCCCCCCCHHHH | 34.38 | 28490779 | |
149 | Phosphorylation | PRNLSDASEGELQEI CCCCCCCCHHHHHHH | 51.64 | 28490779 | |
178 (in isoform 2) | Phosphorylation | - | 12.15 | 27794539 | |
178 (in isoform 4) | Phosphorylation | - | 12.15 | 27794539 | |
178 (in isoform 6) | Phosphorylation | - | 12.15 | 27794539 | |
178 (in isoform 8) | Phosphorylation | - | 12.15 | 27794539 | |
201 | Methylation | DLRGKFVKPALKKVS HHCCCCHHHHHHHHH | 27.92 | - | |
201 | "N6,N6,N6-trimethyllysine" | DLRGKFVKPALKKVS HHCCCCHHHHHHHHH | 27.92 | - | |
205 | "N6,N6,N6-trimethyllysine" | KFVKPALKKVSKYEN CCHHHHHHHHHHHHH | 53.92 | - | |
205 | Methylation | KFVKPALKKVSKYEN CCHHHHHHHHHHHHH | 53.92 | - | |
208 | Phosphorylation | KPALKKVSKYENKFA HHHHHHHHHHHHHHH | 38.10 | 27794539 | |
239 (in isoform 10) | Phosphorylation | - | 34.06 | 27794539 | |
239 | Phosphorylation | VVKKKEFTLEEEEKE HEEECCCCCCHHHHH | 34.06 | 27794539 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TNNI_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TNNI_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TNNI_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GBB2_DROME | Gbeta76C | physical | 14605208 | |
TNNC2_DROME | TpnC47D | physical | 14605208 | |
RL22_DROME | RpL22 | physical | 14605208 | |
TPM2_DROME | Tm2 | physical | 22036573 | |
TNNT_DROME | up | physical | 22036573 | |
MYSA_DROME | Mhc | physical | 22036573 | |
TNNC1_DROME | TpnC41C | physical | 22036573 | |
AT5F1_DROME | ATPsyn-b | physical | 22036573 | |
ATP5J_DROME | ATPsyn-Cf6 | physical | 22036573 | |
ATPK_DROME | CG4692 | physical | 22036573 | |
ICLN_DROME | icln | physical | 22036573 | |
ATPO_DROME | Oscp | physical | 22036573 | |
GSTS1_DROME | GstS1 | physical | 22036573 | |
FTN_DROME | fln | physical | 22036573 | |
MYSA_DROME | Mhc | genetic | 10085296 | |
MYSA_DROME | Mhc | genetic | 12750333 | |
MYSA_DROME | Mhc | genetic | 14718563 | |
MYSA_DROME | Mhc | genetic | 25747460 | |
TPM2_DROME | Tm2 | genetic | 11359941 | |
ATC1_DROME | Ca-P60A | genetic | 24098595 | |
CISY_DROME | kdn | physical | 22036573 | |
ORB2_DROME | orb2 | physical | 26638074 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...