ATPO_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ATPO_DROME
• UniProt AC: Q24439
• Protein Name: ATP synthase subunit O, mitochondrial
• Gene Name: ATPsynO {ECO:0000312|FlyBase:FBgn0016691}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 209
• Subcellular Localization: Mitochondrion. Mitochondrion inner membrane.
• Protein Description: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements..
• Protein Sequence: MASINKLALLSRTLSSAAAQATVKPPVQVFGLEGRYATALYSAASKLSQLDQVEKDLTALQATIRSDKKLREYVTSPIINKKVMATALKEASEKLRFAPATVNLLGLLADNGRLKKLDTVINAYKTIMAAHRGEVVCEVVTAKPLDASQSKQLEGALKSFLKGNESLKITSRVDPSIIGGLIVSIGDKYVDMSIATKVKLYTDVIQTAA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
55	Acetylation	SQLDQVEKDLTALQA HHHHHHHHHHHHHHH	60.21	21791702
151	Acetylation	PLDASQSKQLEGALK CCCHHHHHHHHHHHH	51.79	21791702
151	Ubiquitination	PLDASQSKQLEGALK CCCHHHHHHHHHHHH	51.79	31113955
158	Acetylation	KQLEGALKSFLKGNE HHHHHHHHHHHCCCC	38.33	21791702
162	Acetylation	GALKSFLKGNESLKI HHHHHHHCCCCCCCC	58.65	21791702

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ATPO_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ATPO_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ATPO_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AT5F1_DROME	ATPsyn-b	physical	22036573
ATPK_DROME	CG4692	physical	22036573
ATPG_DROME	ATPsyn-gamma	physical	22036573
JAGN_DROME	jagn	physical	22036573
ATPA_DROME	blw	physical	25023514
ATPK_DROME	CG4692	physical	25023514
ATPB_DROME	ATPsyn-beta	physical	25023514

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.