FTN_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FTN_DROME
• UniProt AC: P35554
• Protein Name: Flightin
• Gene Name: fln
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 182
• Protein Description: Possibly involved in the regulation of flight muscles contraction, possibly by modulating actin-myosin interaction..
• Protein Sequence: MADEEDPWGFDDGGEEEKAASTQAGTPAPPSKAPSVASDHKADSVVAGTPANEEAAPEEVEEIKAPPPPPEDDGYRKPVQLYRHWVRPKFLQYKYMYNYRTNYYDDVIDYIDKKQTGVAREIPRPQTWAERVLRTRNISGSDIDSYAPAKRDKQLIQTLAASIRTYNYHTKAYINQRYASVL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
21	Phosphorylation	GEEEKAASTQAGTPA CHHHHHHHCCCCCCC	26.38	28490779
22	Phosphorylation	EEEKAASTQAGTPAP HHHHHHHCCCCCCCC	20.08	28490779
26	Phosphorylation	AASTQAGTPAPPSKA HHHCCCCCCCCCCCC	21.20	27794539
31	Phosphorylation	AGTPAPPSKAPSVAS CCCCCCCCCCCCCCC	40.15	27794539
35	Phosphorylation	APPSKAPSVASDHKA CCCCCCCCCCCCCCC	34.86	28490779
38	Phosphorylation	SKAPSVASDHKADSV CCCCCCCCCCCCCCE	37.78	28490779
44	Phosphorylation	ASDHKADSVVAGTPA CCCCCCCCEEECCCC	24.29	27794539
49	Phosphorylation	ADSVVAGTPANEEAA CCCEEECCCCCCCCC	14.97	28490779
139	Phosphorylation	VLRTRNISGSDIDSY HHHHCCCCCCCCHHH	35.47	28490779
145	Phosphorylation	ISGSDIDSYAPAKRD CCCCCCHHHCCCHHH	24.43	28490779
158	Phosphorylation	RDKQLIQTLAASIRT HHHHHHHHHHHHHHH	16.03	17912596
162	Phosphorylation	LIQTLAASIRTYNYH HHHHHHHHHHHCCHH	13.65	17912596

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FTN_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FTN_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FTN_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GSTS1_DROME	GstS1	physical	22036573
MYSA_DROME	Mhc	physical	22036573
COX5A_DROME	CoVa	physical	22036573
MYSA_DROME	Mhc	genetic	12750333
CISY_DROME	kdn	physical	22036573
MYSA_DROME	Mhc	physical	12663941

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.