UniProt ID | RHO1_DROME | |
---|---|---|
UniProt AC | P48148 | |
Protein Name | Ras-like GTP-binding protein Rho1 | |
Gene Name | Rho1 {ECO:0000312|FlyBase:FBgn0014020} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 192 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . Cytoplasm, cytoskeleton. |
|
Protein Description | Has a role in regulating actin cytoskeletal organization: required during early development for proper execution of morphogenetic movements of individual cells and groups of cells important for the formation of the embryonic body plan. [PubMed: 10556060] | |
Protein Sequence | MTTIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVKKRKKTRCLLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
34 | Phosphorylation | KDQFPEVYVPTVFEN CCCCCCEECCCEECC | 10.07 | 19429919 | |
37 | Phosphorylation | FPEVYVPTVFENYVA CCCEECCCEECCEEE | 27.99 | 19429919 | |
66 | Phosphorylation | DTAGQEDYDRLRPLS ECCCCCCHHHCCCCC | 11.38 | 19429919 | |
135 | Ubiquitination | IRDLAKMKQEPVKPQ HHHHHHHCCCCCCCC | 51.29 | 31113955 | |
156 | Phosphorylation | EKINAFAYLECSAKS HHHHHHHEEECCCCC | 9.15 | 25749252 | |
189 | Methylation | KKRKKTRCLLL---- HHCCCCCEEEC---- | 3.67 | - | |
189 | Geranylgeranylation | KKRKKTRCLLL---- HHCCCCCEEEC---- | 3.67 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RHO1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RHO1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RHO1_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SQH_DROME | sqh | genetic | 17568577 | |
CDC42_DROME | Cdc42 | genetic | 19506041 | |
AFF4_DROME | lilli | genetic | 11171404 | |
CAPU_DROME | capu | genetic | 10556060 | |
DIA_DROME | dia | genetic | 18256194 | |
DIA_DROME | dia | genetic | 10485851 | |
ENA_DROME | ena | genetic | 23831567 | |
CADF_DROME | tsr | genetic | 23831567 | |
CDC37_DROME | Cdc37 | genetic | 7835340 | |
CTNA_DROME | alpha-Cat | genetic | 12135916 | |
CRB_DROME | crb | genetic | 18585373 | |
JNK_DROME | bsk | genetic | 20404112 | |
FRIZ_DROME | fz | genetic | 17652348 | |
PARP_DROME | Parp | genetic | 11744702 | |
GNAL_DROME | cta | genetic | 10556060 | |
CAPU_DROME | capu | physical | 16518391 | |
CAPU_DROME | capu | physical | 19633175 | |
WASH1_DROME | wash | physical | 19633175 | |
WASH1_DROME | wash | physical | 25739458 | |
SPIR_DROME | spir | physical | 16518391 | |
SPIR_DROME | spir | physical | 19633175 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...