UniProt ID | CDC42_DROME | |
---|---|---|
UniProt AC | P40793 | |
Protein Name | Cdc42 homolog | |
Gene Name | Cdc42 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 191 | |
Subcellular Localization |
Cell junction, adherens junction . Cell membrane Lipid-anchor . Adherens junctions of developing photoreceptor cells. |
|
Protein Description | Regulates mbt kinase activity and is also required to recruit mbt to adherens junctions. Together with mbt, regulates photoreceptor cell morphogenesis.. | |
Protein Sequence | MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLAKNKQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTKKRKCKFL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CDC42_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CDC42_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDC42_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NOTCH_DROME | N | genetic | 11016838 | |
C3G_DROME | C3G | genetic | 15169836 | |
AFF4_DROME | lilli | genetic | 15834142 | |
PROF_DROME | chic | genetic | 12453459 | |
NUMB_DROME | numb | genetic | 15169836 | |
CHK1_DROME | grp | genetic | 15169836 | |
RAC1_DROME | Rac1 | genetic | 14588242 | |
BOULE_DROME | bol | genetic | 15834142 | |
Y2138_DROME | CG32138 | genetic | 26801180 | |
E78C_DROME | Eip78C | genetic | 15834142 | |
DCO_DROME | dco | genetic | 15834142 | |
POE_DROME | poe | genetic | 15169836 | |
PAKM_DROME | mbt | physical | 12490550 | |
GEK_DROME | gek | physical | 9371783 | |
Y2138_DROME | CG32138 | physical | 26801180 | |
DSX_DROME | dsx | physical | 25242320 | |
M3KSL_DROME | slpr | physical | 20736302 | |
APKC_DROME | aPKC | physical | 23250210 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...