dbPTM

CDC42_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CDC42_DROME
UniProt AC	P40793
Protein Name	Cdc42 homolog
Gene Name	Cdc42
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	191
Subcellular Localization	Cell junction, adherens junction . Cell membrane Lipid-anchor . Adherens junctions of developing photoreceptor cells.
Protein Description	Regulates mbt kinase activity and is also required to recruit mbt to adherens junctions. Together with mbt, regulates photoreceptor cell morphogenesis..
Protein Sequence	MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLAKNKQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTKKRKCKFL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
188	Methylation	EPTKKRKCKFL---- CCCCCCCCCCC----	4.35	-
188	Geranylgeranylation	EPTKKRKCKFL---- CCCCCCCCCCC----	4.35	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CDC42_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CDC42_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CDC42_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NOTCH_DROME	N	genetic	11016838
C3G_DROME	C3G	genetic	15169836
AFF4_DROME	lilli	genetic	15834142
PROF_DROME	chic	genetic	12453459
NUMB_DROME	numb	genetic	15169836
CHK1_DROME	grp	genetic	15169836
RAC1_DROME	Rac1	genetic	14588242
BOULE_DROME	bol	genetic	15834142
Y2138_DROME	CG32138	genetic	26801180
E78C_DROME	Eip78C	genetic	15834142
DCO_DROME	dco	genetic	15834142
POE_DROME	poe	genetic	15169836
PAKM_DROME	mbt	physical	12490550
GEK_DROME	gek	physical	9371783
Y2138_DROME	CG32138	physical	26801180
DSX_DROME	dsx	physical	25242320
M3KSL_DROME	slpr	physical	20736302
APKC_DROME	aPKC	physical	23250210

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CDC42_DROME

Related Literatures of Post-Translational Modification