UniProt ID | DCO_DROME | |
---|---|---|
UniProt AC | O76324 | |
Protein Name | Discs overgrown protein kinase | |
Gene Name | dco | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 440 | |
Subcellular Localization | ||
Protein Description | Involved in circadian rhythms, viability and molecular oscillations of the clock genes period (per) and timeless (tim). Dbt reduces the stability and thus the accumulation of monomeric per proteins, probably through phosphorylation. No evident circadian oscillation is detected in head. Together with CkIalpha, regulates processing of ci by phosphorylating it which promotes its binding to slmb, the F-box recognition component of the SCF(slmb) E3 ubiquitin-protein ligase. [PubMed: 16326393] | |
Protein Sequence | MELRVGNKYRLGRKIGSGSFGDIYLGTTINTGEEVAIKLECIRTKHPQLHIESKFYKTMQGGIGIPRIIWCGSEGDYNVMVMELLGPSLEDLFNFCSRRFSLKTVLLLADQMISRIDYIHSRDFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKFRDARSLKHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGALPWQGLKAANKRQKYERISEKKLSTSIVVLCKGFPSEFVNYLNFCRQMHFDQRPDYCHLRKLFRNLFHRLGFTYDYVFDWNLLKFGGPRNPQAIQQAQDGADGQAGHDAVAAAAAVAAAAAASSHQQQQHKVNAALGGGGGSAAQQQLQGGQTLAMLGGNGGGNGSQLIGGNGLNMDDSMAATNSSRPPYDTPERRPSIRMRQGGGGGGGGVGVGGMPSGGGGGGVGNAK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
57 | Acetylation | HIESKFYKTMQGGIG EEEHHHHHHHCCCCC | 40.42 | 21791702 | |
333 | Phosphorylation | VAAAAAASSHQQQQH HHHHHHHHHHHHHHH | 24.51 | 22817900 | |
334 | Phosphorylation | AAAAAASSHQQQQHK HHHHHHHHHHHHHHH | 22.16 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DCO_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DCO_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DCO_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PER_DROME | per | physical | 9674431 | |
KC1A_DROME | CkIalpha | physical | 22036573 | |
PER_DROME | per | genetic | 11084344 | |
PER_DROME | per | genetic | 24820422 | |
DSH_DROME | dsh | genetic | 16824922 | |
KC1A_DROME | CkIalpha | genetic | 16824921 | |
WARTS_DROME | wts | genetic | 20979026 | |
WARTS_DROME | wts | genetic | 19574458 | |
FRIZ_DROME | fz | genetic | 16824922 | |
PRIC1_DROME | pk | genetic | 16824921 | |
PER_DROME | per | physical | 11430804 | |
PER_DROME | per | physical | 17452449 | |
PER_DROME | per | physical | 17893330 | |
PER_DROME | per | physical | 20980603 | |
PER_DROME | per | physical | 27542830 | |
PER_DROME | per | physical | 18957703 | |
PER_DROME | per | physical | 25939385 | |
TIM_DROME | tim | physical | 11430804 | |
FAT_DROME | ft | physical | 19540118 | |
CI_DROME | ci | physical | 25512501 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-333 AND SER-334, ANDMASS SPECTROMETRY. |