BOULE_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BOULE_DROME
• UniProt AC: Q24207
• Protein Name: Protein boule
• Gene Name: bol
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 228
• Subcellular Localization: Nucleus . Cytoplasm . Nuclear in primary spermatocytes until near the end of the meiotic prophase and cytoplasmic localization from then onward.
• Protein Description: RNA-binding protein that plays a central role in spermatogenesis. Required for meiotic entry and germline differentiation, at the transition between G2 and M phases of meiosis I. Acts by regulating translation of specific mRNAs, possibly by binding to their 3'-UTR. Essential for translation of twine (twe) mRNA. Required for the expression of various genes such as CG6784, CG17210, CG15841 scpr-B, scpr-C, and rho-6..
• Protein Sequence: MHKIAAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKGYGFVTFETEQEAQRLQADGECVVLRDRKLNIAPAIKKQPNPLQSIVATNGAVYYTTTPPAPISNIPMDQFAAAVYPPAAGVPAIYPPSAMQYQPFYQYYSVPMNVPTIWPQNYQENHSPLLHSPTSNPHSPHSQSHPQSPCWSIEDLRDTLPRV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of BOULE_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BOULE_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BOULE_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BOULE_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TWINE_DROME	twe	genetic	10559904

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.