TWINE_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TWINE_DROME
• UniProt AC: Q03019
• Protein Name: Cdc25-like protein phosphatase twine
• Gene Name: twe
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 426
• Protein Description: Required during meiosis. Regulates the transition from the extended G2 phase to the onset of the first meiotic division..
• Protein Sequence: MASKRLMLDVEEEDDESGACGQENFDPHDADMEYQAKRRKSAVQETPLQWMLKRHIPASTTVLSPITELSQNMNGARLDGTPKSTQRIPANRTLNNFNSLSSRTLGSFSSSCSSYESGNSLDDEYMDMFEMESAENHNLELPDDLEVLLSGQLKSESNLEEMSNKKGSLRRCLSMYPSEQPEEAVQEPDQETNMPMKKMQRKTLSMNDAEIMRALGDEPELIGDLSKPCTLPCLATGIRHRDLKTISSDTLARLIQGEFDEQLGSQGGYEIIDCRYPYEFLGGHIRGAKNLYTRGQIQEAFPTLTSNQENRRIYVFHCEFSSERGPKLLRYLRSNDRSQHTHNYPALDYPELYILHNGYKEFFGLYSQLCQPSQYVPMLAPAHNDEFRYFRAKTKSWQCGEGGDSGIGGGGSRGLRKSRSRLLYAE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
396	Phosphorylation	YFRAKTKSWQCGEGG EEEECCCCCCCCCCC	27.84	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TWINE_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TWINE_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TWINE_DROME !!

Protein-Protein Interaction

Oops, there are no PPI records of TWINE_DROME !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.