dbPTM

RAC1_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RAC1_DROME
UniProt AC	P40792
Protein Name	Ras-related protein Rac1
Gene Name	Rac1
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	192
Subcellular Localization	Cell membrane Lipid-anchor Cytoplasmic side .
Protein Description	Involved in axon outgrowth and myoblast fusion. Plays a role in regulating dorsal closure during embryogenesis. Involved in integrin alpha-PS3/beta-nu-mediated phagocytosis of Gram-positive S.aureus by hemocytes..
Protein Sequence	MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKRKCALL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
64	Phosphorylation	DTAGQEDYDRLRPLS CCCCCCCHHHCCCCC	11.38	19429919
189	Methylation	QPKSKRKCALL---- CCCCCCCCCCC----	3.61	-
189	Geranylgeranylation	QPKSKRKCALL---- CCCCCCCCCCC----	3.61	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RAC1_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RAC1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RAC1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PKN_DROME	Pkn	physical	15710747
RG68F_DROME	RhoGAP68F	physical	15710747
CDGAP_DROME	CdGAPr	physical	15710747
DCR1_DROME	Dcr-1	physical	15710747
PLXB_DROME	PlexB	physical	15710747
2AAA_DROME	Pp2A-29B	physical	15710747
CLH_DROME	Chc	physical	15710747
M3KSL_DROME	slpr	physical	15710747
SPRI_DROME	spri	physical	15710747
ACT1_DROME	Act5C	genetic	15242648
SQH_DROME	sqh	genetic	12505998
C3G_DROME	C3G	genetic	15169836
JAK_DROME	hop	genetic	16000386
LIMK1_DROME	LIMK1	genetic	15572110
HEP_DROME	hep	genetic	10985385
HEP_DROME	hep	genetic	11825878
AFF4_DROME	lilli	genetic	15834142
MAD_DROME	Mad	genetic	20510858
PROF_DROME	chic	genetic	12453459
PROF_DROME	chic	genetic	15242648
NUMB_DROME	numb	genetic	15169836
SOS_DROME	Sos	genetic	25099352
MYO7A_DROME	ck	genetic	12505998
CHK1_DROME	grp	genetic	15169836
JRA_DROME	Jra	genetic	9224721
JRA_DROME	Jra	genetic	10985385
ARF6_DROME	Arf51F	genetic	23468526
DIAP2_DROME	Iap2	genetic	15242648
RHO1_DROME	Rho1	genetic	10985385
RHO1_DROME	Rho1	genetic	12505998
CADE_DROME	shg	genetic	16412417
FMR1_DROME	Fmr1	genetic	12818175
FMR1_DROME	Fmr1	genetic	15964283
MYSN_DROME	zip	genetic	12505998
RAC2_DROME	Rac2	genetic	16412417
DRONC_DROME	Nc	genetic	15242648
Y2138_DROME	CG32138	genetic	26801180
DIAP1_DROME	th	genetic	15242648
GIL_DROME	aos	genetic	10985385
TRC_DROME	trc	genetic	15479641
E78C_DROME	Eip78C	genetic	15834142
CYFIP_DROME	Sra-1	genetic	12818175
STAT_DROME	Stat92E	genetic	16000386
DCO_DROME	dco	genetic	15834142
PLXB_DROME	PlexB	genetic	11604137
M3KSL_DROME	slpr	genetic	11825878
M3KSL_DROME	slpr	genetic	19064708
CUT_DROME	ct	genetic	18093520
JNK_DROME	bsk	genetic	10985385
JNK_DROME	bsk	genetic	11825878
JNK_DROME	bsk	genetic	17032066
JNK_DROME	bsk	genetic	19064708
PRIC1_DROME	pk	genetic	10985385
CPO_DROME	cpo	genetic	15169836
DYN_DROME	shi	genetic	16412417
POE_DROME	poe	genetic	15169836
HMG2_DROME	Dsp1	genetic	15834142
RG84C_DROME	RacGAP84C	genetic	11468292
Y2138_DROME	CG32138	physical	26801180
CYFIP_DROME	Sra-1	physical	12818175
M3KSL_DROME	slpr	physical	20736302

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RAC1_DROME

Related Literatures of Post-Translational Modification