UniProt ID | TRC_DROME | |
---|---|---|
UniProt AC | Q9NBK5 | |
Protein Name | Serine/threonine-protein kinase tricorner | |
Gene Name | trc {ECO:0000312|EMBL:AAF67167.1, ECO:0000312|FlyBase:FBgn0003744} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 463 | |
Subcellular Localization | Cytoplasm . Nucleus . Trc colocalizes with Mob1 to the cell periphery in wing cells and wing hairs. | |
Protein Description | Has an important role, with fry, in controlling cell structure and proliferation of a variety of polarized outgrowths including epidermal hairs, bristles, arista laterals, and dendrites. Affects cellular morphogenesis by regulating the expression of target genes that encode cytoskeleton-interacting proteins and not via the direct modification of the cytoskeleton. Maintains the integrity of epidermal hairs and is an essential component of the signaling pathway regulating dendritic branching of sensory neurons.. | |
Protein Sequence | MMSSRTQDADGASIRFSDHTLDKATKAKVTLENYYSNLVTQYGERKQRLAKLEAQLKDESLSEAQRQEKRLQHAQKETEYLRLKRLRLGVEDFEALKVIGRGAFGEVRLVQKKDTGHVYAMKVLRKADMLEKEQVAHVRAERDVLVEADHQWVVKMYYSFQDPVNLYLIMEFLPGGDMMTLLMKKDTLSEEGTQFYISETALAIDSIHKLGFIHRDIKPDNLLLDARGHLKLSDFGLCTGLKKSHRTDFYRDLSQAKPSDFIGTCASLSCSPMDSKRRAESWKRNRRALAYSTVGTPDYIAPEVFLQTGYGPACDWWSLGVIMYEMLMGYPPFCSDNPQDTYRKVMNWRETLIFPPEIPISEEAKETIINFCCEADRRLGSQRGLEDLKSVPFFRGVDWEHIRERPAAIPVEVRSIDDTSNFDEFPDVSLEIPSAPIPQGGEIAKDWVFINYTYKRFEVRNLE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRC_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRC_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRC_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RALA_DROME | Rala | genetic | 15591127 | |
CDC42_DROME | Cdc42 | genetic | 15591127 | |
RHO1_DROME | Rho1 | genetic | 15591127 | |
RAC1_DROME | Rac1 | genetic | 15591127 | |
RAC1_DROME | Rac1 | genetic | 15479641 | |
FRY_DROME | fry | genetic | 15591127 | |
MOB2_DROME | Mob2 | genetic | 15975907 | |
MOB1_DROME | mats | genetic | 15975907 | |
WARTS_DROME | wts | genetic | 15975907 | |
JNK_DROME | bsk | genetic | 15591127 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Control of dendritic branching and tiling by the Tricornered-kinase/Furry signaling pathway in Drosophila sensory neurons."; Emoto K., He Y., Ye B., Grueber W.B., Adler P.N., Jan L.Y., Jan Y.-N.; Cell 119:245-256(2004). Cited for: FUNCTION, ENZYME ACTIVITY, TISSUE SPECIFICITY, PHOSPHORYLATION ATSER-292 AND THR-453, MUTAGENESIS OF SER-292 AND THR-453, ANDDISRUPTION PHENOTYPE. |