dbPTM

TRC_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TRC_DROME
UniProt AC	Q9NBK5
Protein Name	Serine/threonine-protein kinase tricorner
Gene Name	trc {ECO:0000312\|EMBL:AAF67167.1, ECO:0000312\|FlyBase:FBgn0003744}
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	463
Subcellular Localization	Cytoplasm . Nucleus . Trc colocalizes with Mob1 to the cell periphery in wing cells and wing hairs.
Protein Description	Has an important role, with fry, in controlling cell structure and proliferation of a variety of polarized outgrowths including epidermal hairs, bristles, arista laterals, and dendrites. Affects cellular morphogenesis by regulating the expression of target genes that encode cytoskeleton-interacting proteins and not via the direct modification of the cytoskeleton. Maintains the integrity of epidermal hairs and is an essential component of the signaling pathway regulating dendritic branching of sensory neurons..
Protein Sequence	MMSSRTQDADGASIRFSDHTLDKATKAKVTLENYYSNLVTQYGERKQRLAKLEAQLKDESLSEAQRQEKRLQHAQKETEYLRLKRLRLGVEDFEALKVIGRGAFGEVRLVQKKDTGHVYAMKVLRKADMLEKEQVAHVRAERDVLVEADHQWVVKMYYSFQDPVNLYLIMEFLPGGDMMTLLMKKDTLSEEGTQFYISETALAIDSIHKLGFIHRDIKPDNLLLDARGHLKLSDFGLCTGLKKSHRTDFYRDLSQAKPSDFIGTCASLSCSPMDSKRRAESWKRNRRALAYSTVGTPDYIAPEVFLQTGYGPACDWWSLGVIMYEMLMGYPPFCSDNPQDTYRKVMNWRETLIFPPEIPISEEAKETIINFCCEADRRLGSQRGLEDLKSVPFFRGVDWEHIRERPAAIPVEVRSIDDTSNFDEFPDVSLEIPSAPIPQGGEIAKDWVFINYTYKRFEVRNLE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
292	Phosphorylation	NRRALAYSTVGTPDY HHHHHHHCCCCCCCC	15.83	15479641
453	Phosphorylation	DWVFINYTYKRFEVR CEEEEEEEEEEEEEE	20.34	12537569

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TRC_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TRC_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TRC_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RALA_DROME	Rala	genetic	15591127
CDC42_DROME	Cdc42	genetic	15591127
RHO1_DROME	Rho1	genetic	15591127
RAC1_DROME	Rac1	genetic	15591127
RAC1_DROME	Rac1	genetic	15479641
FRY_DROME	fry	genetic	15591127
MOB2_DROME	Mob2	genetic	15975907
MOB1_DROME	mats	genetic	15975907
WARTS_DROME	wts	genetic	15975907
JNK_DROME	bsk	genetic	15591127

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TRC_DROME

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Control of dendritic branching and tiling by the Tricornered-kinase/Furry signaling pathway in Drosophila sensory neurons."; Emoto K., He Y., Ye B., Grueber W.B., Adler P.N., Jan L.Y., Jan Y.-N.; Cell 119:245-256(2004). Cited for: FUNCTION, ENZYME ACTIVITY, TISSUE SPECIFICITY, PHOSPHORYLATION ATSER-292 AND THR-453, MUTAGENESIS OF SER-292 AND THR-453, ANDDISRUPTION PHENOTYPE.	15479641 [Abstract]