MOB1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MOB1_DROME
• UniProt AC: Q95RA8
• Protein Name: MOB kinase activator-like 1
• Gene Name: mats {ECO:0000312|FlyBase:FBgn0038965}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 219
• Subcellular Localization: Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Nucleus. Cytoplasm, cytosol. Cell membrane. Colocalizes with wts and cyclin E at the centrosome.
• Protein Description: Coactivator of Warts (Wts) kinase in the Hippo/SWH (Sav/Wts/Hpo)signaling pathway, a signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein Hippo (Hpo), in complex with its regulatory protein Salvador (Sav), phosphorylates and activates Warts (Wts) in complex with its regulatory protein Mats, which in turn phosphorylates and inactivates the Yorkie (Yki)oncoprotein. The Hippo/SWH signaling pathway inhibits the activity of the transcriptional complex formed by Scalloped (sd) and Yki and the target genes of this pathway include cyclin-E (cycE), diap1 and bantam. Mats is essential for early development and is required for proper chromosomal segregation in developing embryos..
• Protein Sequence: MDFLFGSRSSKTFKPKKNIPEGTHQYDLMKHAAATLGSGNLRNAVALPDGEDLNEWVAVNTVDFFNQINMLYGTITEFCTEETCGIMSAGPKYEYHWADGLTVKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFHSSAKTILKRLFRVYAHIYHQHFTEVVTLGEEAHLNTSFKHFIFFVQEFNLIERRELAPLQELIDKLTAKDERQI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
23	Phosphorylation	KKNIPEGTHQYDLMK CCCCCCCCCHHHHHH	12.25	21082442
35	Phosphorylation	LMKHAAATLGSGNLR HHHHHHHHCCCCCCC	27.25	19429919
38	Phosphorylation	HAAATLGSGNLRNAV HHHHHCCCCCCCCCE	27.85	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MOB1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MOB1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MOB1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TRC_DROME	trc	physical	14605208
YAP1_DROME	yki	genetic	26592338
OST48_DROME	Ost48	physical	24114784
RS8_DROME	RpS8	physical	24114784
WARTS_DROME	wts	physical	15766530
ATNA_DROME	Atpalpha	physical	24114784
ATC1_DROME	Ca-P60A	physical	24114784

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.