UniProt ID | MOB2_DROME | |
---|---|---|
UniProt AC | Q8IQG1 | |
Protein Name | MOB kinase activator-like 2 | |
Gene Name | Mob2 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 566 | |
Subcellular Localization | Cytoplasm . Nucleus . Trc colocalizes with Mob1 to the cell periphery in wing cells and wing hairs. | |
Protein Description | Required for the normal morphogenesis of a variety of polarized outgrowths including epidermal hairs, bristles, arista laterals, and dendrites.. | |
Protein Sequence | MNWAISNLTGGNRVSRAILVRYSSVPLADATNDGSSTAPQTPTASTPRPSSSHSSLSSTFAATFLHASSRHIPGRAVPRQNANGQNGGKGNASGAGGGAGGGGAGGASGGTGGTGAQAAGQLSLPLDVEETVTCFCRKARRKERDGDQNSTDTKLYLEESVLERKLPEADLKALVDLPAGLDYNEWLASHTLALFEHVNLVYGTISEFCTQSGCADMTGPGNRTYLWFDEKGKKTRVAAPQYIDYVMTFTQKTVSDESIFPTKYANEFPGSFESIARKILRLQFHVIAHLYAAHFREIALLGLHTHLNLTFAHLTALHRRFNLIDEKETDVLRDLEVALRLTDDTGGCQDATSTTSSVHDHSHSGDLQHQSLQQQQQHHNSSSNSTSSAEAFHVNSQSNNGSTSASASVSLIDGDAVAPPICTQPEAGAGCKPAGSSGLLGGILGDLTSGEFGDTTRYCTSAVPQAAAAAGAGVGGTAIGATDAAALNNGAGALHLNFSNNNNNNHNLNHHHHHHHHHGHHGHHHAAQQQQQHSGLIQCNAAGGGGNATGVATGGATAAASSTTTA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of MOB2_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MOB2_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MOB2_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MOB2_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HMIN_DROME | inv | physical | 14605208 | |
MS87F_DROME | Mst87F | physical | 14605208 | |
SPY_DROME | sty | physical | 14605208 | |
RS15A_DROME | RpS15Aa | physical | 14605208 | |
SDHB_DROME | SdhB | physical | 14605208 | |
RS3_DROME | RpS3 | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...