dbPTM

MOB2_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MOB2_DROME
UniProt AC	Q8IQG1
Protein Name	MOB kinase activator-like 2
Gene Name	Mob2
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	566
Subcellular Localization	Cytoplasm . Nucleus . Trc colocalizes with Mob1 to the cell periphery in wing cells and wing hairs.
Protein Description	Required for the normal morphogenesis of a variety of polarized outgrowths including epidermal hairs, bristles, arista laterals, and dendrites..
Protein Sequence	MNWAISNLTGGNRVSRAILVRYSSVPLADATNDGSSTAPQTPTASTPRPSSSHSSLSSTFAATFLHASSRHIPGRAVPRQNANGQNGGKGNASGAGGGAGGGGAGGASGGTGGTGAQAAGQLSLPLDVEETVTCFCRKARRKERDGDQNSTDTKLYLEESVLERKLPEADLKALVDLPAGLDYNEWLASHTLALFEHVNLVYGTISEFCTQSGCADMTGPGNRTYLWFDEKGKKTRVAAPQYIDYVMTFTQKTVSDESIFPTKYANEFPGSFESIARKILRLQFHVIAHLYAAHFREIALLGLHTHLNLTFAHLTALHRRFNLIDEKETDVLRDLEVALRLTDDTGGCQDATSTTSSVHDHSHSGDLQHQSLQQQQQHHNSSSNSTSSAEAFHVNSQSNNGSTSASASVSLIDGDAVAPPICTQPEAGAGCKPAGSSGLLGGILGDLTSGEFGDTTRYCTSAVPQAAAAAGAGVGGTAIGATDAAALNNGAGALHLNFSNNNNNNHNLNHHHHHHHHHGHHGHHHAAQQQQQHSGLIQCNAAGGGGNATGVATGGATAAASSTTTA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of MOB2_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MOB2_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MOB2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MOB2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HMIN_DROME	inv	physical	14605208
MS87F_DROME	Mst87F	physical	14605208
SPY_DROME	sty	physical	14605208
RS15A_DROME	RpS15Aa	physical	14605208
SDHB_DROME	SdhB	physical	14605208
RS3_DROME	RpS3	physical	14605208

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MOB2_DROME

Related Literatures of Post-Translational Modification