UniProt ID | RS3_DROME | |
---|---|---|
UniProt AC | Q06559 | |
Protein Name | 40S ribosomal protein S3 | |
Gene Name | RpS3 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 246 | |
Subcellular Localization | Cytoplasm. Nucleus. | |
Protein Description | Has DNA repair activity directed towards the mutagenic lesions 8-oxoguanine and abasic sites in DNA. It can cleave DNA containing 8-oxoguanine residues efficiently. Also acts as an ap lyase, cleaving phosphodiester bonds via a beta,delta elimination reaction.. | |
Protein Sequence | MNANLPISKKRKFVSDGIFKAELNEFLTRELAEDGYSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIRELTAMVQKRFNFETGRIELYAEKVAARGLCAIAQAESLRYKLTGGLAVRRACYGVLRYIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVETATRHVLLRQGVLGIKVKVMLPYDPKNKIGPKKPLPDNVSVVEPKEEKIYETPETEYKIPPPSKPLDDLSEAKVL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
64 | Acetylation | TQQVLGEKGRRIREL HHHHHHHHHHHHHHH | 56.79 | 21791702 | |
92 | Acetylation | RIELYAEKVAARGLC CEEEHHHHHHHHHHH | 29.06 | 21791702 | |
197 | Acetylation | VMLPYDPKNKIGPKK EECCCCCCCCCCCCC | 68.89 | 21791702 | |
211 | Phosphorylation | KPLPDNVSVVEPKEE CCCCCCCEEECCCCC | 27.05 | 22817900 | |
219 | Acetylation | VVEPKEEKIYETPET EECCCCCCEECCCCC | 52.24 | 21791702 | |
221 | Phosphorylation | EPKEEKIYETPETEY CCCCCCEECCCCCCC | 25.48 | 22817900 | |
223 | Phosphorylation | KEEKIYETPETEYKI CCCCEECCCCCCCCC | 14.95 | 18327897 | |
226 | Phosphorylation | KIYETPETEYKIPPP CEECCCCCCCCCCCC | 45.90 | 18327897 | |
228 | Phosphorylation | YETPETEYKIPPPSK ECCCCCCCCCCCCCC | 22.95 | 18281928 | |
241 | Phosphorylation | SKPLDDLSEAKVL-- CCCCCCHHHCCCC-- | 42.37 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS3_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS3_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS3_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PP2A_DROME | mts | physical | 14605208 | |
MSS4_DROME | CG7787 | physical | 14605208 | |
ASGL1_DROME | CG7860 | physical | 14605208 | |
WHITE_DROME | w | genetic | 2540060 | |
WHITE_DROME | w | genetic | 2168335 | |
ZEST_DROME | z | genetic | 2540060 | |
DRONC_DROME | Nc | genetic | 25613379 | |
LTV1_DROME | CG7686 | physical | 25858587 | |
ER_DROME | e(r) | physical | 27830090 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-223; THR-226 ANDSER-241, AND MASS SPECTROMETRY. |