ER_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ER_DROME
• UniProt AC: Q24337
• Protein Name: Protein enhancer of rudimentary
• Gene Name: e(r)
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 104
• Protein Description: Acts as an enhancer of the rudimentary gene. Has a role in pyrimidine biosynthesis and the cell cycle..
• Protein Sequence: MSHTILLVQPGARPETRTYCDYESVNECMEGVCKIYEEHLKRRNPNTPTITYDISQLFDFIDTMVDISCMVYQKSTNTYAPYNKDWIKEKIYVLLRQAAFSSNT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
18	Phosphorylation	GARPETRTYCDYESV CCCCCCCCCCCHHHH	35.60	16849599
24	Phosphorylation	RTYCDYESVNECMEG CCCCCHHHHHHHHHH	24.82	16849599

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
18	T	Phosphorylation	Kinase	CK2	-	Uniprot
24	S	Phosphorylation	Kinase	CK2	-	Uniprot

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ER_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ER_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RT26_DROME	mRpS26	physical	14605208
DTX_DROME	dx	physical	14605208
NUP54_DROME	Nup54	physical	14605208
RL19_DROME	RpL19	physical	27830090
RS3_DROME	RpS3	physical	27830090

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.