UniProt ID | DIAP2_DROME | |
---|---|---|
UniProt AC | Q24307 | |
Protein Name | Death-associated inhibitor of apoptosis 2 | |
Gene Name | Diap2 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 498 | |
Subcellular Localization | Nucleus . Cytoplasm . | |
Protein Description | Required for activation of NF-kappaB transcription factors in the immune deficiency (Imd) signaling cascade which is essential for innate immune responses upon infection by Gram-negative bacteria. [PubMed: 16894030] | |
Protein Sequence | MTELGMELESVRLATFGEWPLNAPVSAEDLVANGFFATGNWLEAECHFCHVRIDRWEYGDQVAERHRRSSPICSMVLAPNHCGNVPRSQESDNEGNSVVDSPESCSCPDLLLEANRLVTFKDWPNPNITPQALAKAGFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQCPRVQMGPLIEFATGKNLDELGIQPTTLPLRPKYACVDARLRTFTDWPISNIQPASALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQFVLLAKGPAYVSEVLATTAANASSQPATAPAPTLQADVLMDEAPAKEALALGIDGGVVRNAIQRKLLSSGCAFSTLDELLHDIFDDAGAGAALEVREPPEPSAPFIEPCQATTSKAASVPIPVADSIPAKPQAAEAVANISKITDEIQKMSVATPNGNLSLEEENRQLKDARLCKVCLDEEVGVVFLPCGHLATCNQCAPSVANCPMCRADIKGFVRTFLS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of DIAP2_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DIAP2_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DIAP2_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DIAP2_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...