dbPTM

Y3800_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	Y3800_DROME
UniProt AC	Q8T8R1
Protein Name	CCHC-type zinc finger protein CG3800
Gene Name	CG3800
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	165
Subcellular Localization
Protein Description
Protein Sequence	MSMSATCYKCNRPGHFARDCSLGGGGGPGGVGGGGGGGGGGMRGNDGGGMRRNREKCYKCNQFGHFARACPEEAERCYRCNGIGHISKDCTQADNPTCYRCNKTGHWVRNCPEAVNERGPTNVSCYKCNRTGHISKNCPETSKTCYGCGKSGHLRRECDEKGGRN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MSMSATCYKCN ----CCCCCEEEECC	17.08	21082442
6	Phosphorylation	--MSMSATCYKCNRP --CCCCCEEEECCCC	14.73	21082442
8	Phosphorylation	MSMSATCYKCNRPGH CCCCCEEEECCCCCC	17.77	21082442
21	Phosphorylation	GHFARDCSLGGGGGP CCCCCCCCCCCCCCC	34.05	21082442
87	Phosphorylation	CNGIGHISKDCTQAD CCCCCCCCCCCCCCC	19.43	22817900
142	Phosphorylation	SKNCPETSKTCYGCG CCCCCCCCCCCCCCC	25.06	22817900
150	Acetylation	KTCYGCGKSGHLRRE CCCCCCCCCCHHHHH	58.29	21791702

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of Y3800_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of Y3800_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of Y3800_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CP306_DROME	phm	physical	14605208
TULP_DROME	ktub	physical	14605208

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of Y3800_DROME

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-142, AND MASSSPECTROMETRY.	18327897 [Abstract]
"An integrated chemical, mass spectrometric and computational strategyfor (quantitative) phosphoproteomics: application to Drosophilamelanogaster Kc167 cells."; Bodenmiller B., Mueller L.N., Pedrioli P.G.A., Pflieger D.,Juenger M.A., Eng J.K., Aebersold R., Tao W.A.; Mol. Biosyst. 3:275-286(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-21, AND MASSSPECTROMETRY.	17372656 [Abstract]