| UniProt ID | CASP8_DROME | |
|---|---|---|
| UniProt AC | Q8IRY7 | |
| Protein Name | Caspase-8 | |
| Gene Name | Dredd | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 494 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Effector of the programmed cell death (PCD) activators rpr, grim and hid. [PubMed: 9740659 May play an apoptotic role in the germline as well as soma. Fadd interacts with Dredd to promote cleavage of Dredd and is necessary and sufficient for enhancing Dredd-induced apoptosis] | |
| Protein Sequence | MAGSNLLIHLDTIDQNDLIYVERDMNFAQKVGLCFLLYGDDHSDATYILQKLLAMTRSDFPQSDLLIKFAKSRPETWRRHLVEALCIIGARKVLRRLGFCWQELRMHYLPHIAGITLHVHPLLKSLYRMCEELSLVQSGRLLLDVREKVESQQAGDPLRFYDPAYLEIFLLDWLTRRSIKLGDINAAGSDVQLLVGHLKSNGLQAQANLLKDTIISNAPEPDAAGTAAMAVKQEIESDNQQSYCSTQIDALKLTRENAGIALIINQQKFHRNVSRDNMKFLSPDPLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHMGIIERIRSACDRSLVRDSLVVFILSHGFEEAVYASNSIAMKITDIEDLLCSYDTLYYKPKLLIIQACQEKLVHKKKPNELFRIDVTTVSPDQHIDMLRAMSTVNGYAALRHTQTGSWFIGSLCDAIDRRSASEHIADILTIVTNEVSKKRGSNDESMVPNVKSTFRQHVYFPPRL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of CASP8_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CASP8_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CASP8_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CASP8_DROME !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
