| UniProt ID | VA0D1_DROME | |
|---|---|---|
| UniProt AC | Q9W4P5 | |
| Protein Name | V-type proton ATPase subunit d 1 | |
| Gene Name | VhaAC39-1 | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 350 | |
| Subcellular Localization | ||
| Protein Description | Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation (By similarity).. | |
| Protein Sequence | MNSSGFMFNIDNGYLEGLCRGFKCGILKQADYLNLVQCETLEDLKLHLQGTDYGSFLANEPSPLSVSVIDDKLREKLVIEFQHMRNHAVEPLSNFLDFITYGYMIDNIILLITGTLHQRPISELIPKCHPLGSFEQMEAIHVASTPAELYNAVLVDTPLAPFFVDCISEQDLDEMNIEIIRNTLYKAYLEAFYNFCKNMGGATADVMCEILAFEADRRAIIITINSFGTELSKDDRAKLYPNCGKMYPDGLAALARADDYEQVKTVAEYYAEYAALFDGSGNNPGDKTLEDKFFEHEVKLDVYAFLQQFHFGVFYAYLKLKEQECRNIVWIAECVAQKHRAKIDNYIPIF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VA0D1_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VA0D1_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VA0D1_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| BAP60_DROME | Bap60 | physical | 14605208 | |
| ARL1_DROME | Arl1 | physical | 14605208 | |
| ALF_DROME | Ald | physical | 14605208 | |
| CREBA_DROME | CrebA | physical | 14605208 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...