dbPTM

VA0D1_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	VA0D1_DROME
UniProt AC	Q9W4P5
Protein Name	V-type proton ATPase subunit d 1
Gene Name	VhaAC39-1
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	350
Subcellular Localization
Protein Description	Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation (By similarity)..
Protein Sequence	MNSSGFMFNIDNGYLEGLCRGFKCGILKQADYLNLVQCETLEDLKLHLQGTDYGSFLANEPSPLSVSVIDDKLREKLVIEFQHMRNHAVEPLSNFLDFITYGYMIDNIILLITGTLHQRPISELIPKCHPLGSFEQMEAIHVASTPAELYNAVLVDTPLAPFFVDCISEQDLDEMNIEIIRNTLYKAYLEAFYNFCKNMGGATADVMCEILAFEADRRAIIITINSFGTELSKDDRAKLYPNCGKMYPDGLAALARADDYEQVKTVAEYYAEYAALFDGSGNNPGDKTLEDKFFEHEVKLDVYAFLQQFHFGVFYAYLKLKEQECRNIVWIAECVAQKHRAKIDNYIPIF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
55	Phosphorylation	LQGTDYGSFLANEPS HCCCCCHHHCCCCCC	15.74	27794539
233	Ubiquitination	SFGTELSKDDRAKLY CCCCCCCHHHHHHHC	76.03	31113955

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of VA0D1_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of VA0D1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of VA0D1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BAP60_DROME	Bap60	physical	14605208
ARL1_DROME	Arl1	physical	14605208
ALF_DROME	Ald	physical	14605208
CREBA_DROME	CrebA	physical	14605208

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of VA0D1_DROME

Related Literatures of Post-Translational Modification