ARL1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARL1_DROME
• UniProt AC: P25160
• Protein Name: ADP-ribosylation factor-like protein 1
• Gene Name: Arl1
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 180
• Protein Description: GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus..
• Protein Sequence: MGGVLSYFRGLLGSREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMDGCMTVAEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSRK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGGVLSYFR ------CCHHHHHHH	34.61	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ARL1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARL1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARL1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TCPG_DROME	Cctgamma	physical	14605208

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.