UniProt ID | TBB1_DROME | |
---|---|---|
UniProt AC | Q24560 | |
Protein Name | Tubulin beta-1 chain | |
Gene Name | betaTub56D | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 447 | |
Subcellular Localization | Cytoplasm, cytoskeleton. | |
Protein Description | Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain (By similarity).. | |
Protein Sequence | MREIVHIQAGQCGNQIGAKFWEIISDEHGIDATGAYHGDSDLQLERINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATADEDAEFEEEQEAEVDEN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
40 | Phosphorylation | TGAYHGDSDLQLERI CCCCCCCCCCEEEEE | 44.83 | 18327897 | |
58 | Acetylation | YNEASGGKYVPRAVL EECCCCCCEECEEEE | 46.75 | 21791702 | |
115 | Phosphorylation | EGAELVDSVLDVVRK CHHHHHHHHHHHHHH | 19.66 | 18327897 | |
274 | Phosphorylation | MPGFAPLTSRGSQQY CCCCCCCCCCCCHHH | 18.47 | 19429919 | |
275 | Phosphorylation | PGFAPLTSRGSQQYR CCCCCCCCCCCHHHE | 42.18 | 19429919 | |
278 | Phosphorylation | APLTSRGSQQYRALT CCCCCCCCHHHEEEE | 17.01 | 19429919 | |
281 | Phosphorylation | TSRGSQQYRALTVPE CCCCCHHHEEEEHHH | 7.10 | 19429919 | |
312 | Phosphorylation | PRHGRYLTVAAIFRG CCCCCCHHHHHHHCC | 10.12 | 21082442 | |
322 | Phosphorylation | AIFRGRMSMKEVDEQ HHHCCCCCHHHHHHH | 25.91 | 21082442 | |
338 | Phosphorylation | LNIQNKNSSYFVEWI HHCCCCCCCHHEEEC | 28.20 | 21082442 | |
339 | Phosphorylation | NIQNKNSSYFVEWIP HCCCCCCCHHEEECC | 31.80 | 21082442 | |
366 | Phosphorylation | RGLKMSATFIGNSTA CCCCEEEEECCCHHH | 14.42 | 21082442 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TBB1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TBB1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TBB1_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CDKAL_DROME | CG6550 | physical | 22036573 | |
C4AC1_DROME | Cyp4ac1 | physical | 22036573 | |
RS27A_DROME | RpS27A | physical | 24292889 | |
PFD3_DROME | mgr | physical | 22451918 | |
PFD2_DROME | l(3)01239 | physical | 27025979 | |
VHL_DROME | Vhl | physical | 20388653 | |
VHL_DROME | Vhl | physical | 22451918 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-40 AND SER-339, AND MASSSPECTROMETRY. |