| UniProt ID | TBB1_DROME | |
|---|---|---|
| UniProt AC | Q24560 | |
| Protein Name | Tubulin beta-1 chain | |
| Gene Name | betaTub56D | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 447 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. | |
| Protein Description | Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain (By similarity).. | |
| Protein Sequence | MREIVHIQAGQCGNQIGAKFWEIISDEHGIDATGAYHGDSDLQLERINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATADEDAEFEEEQEAEVDEN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 40 | Phosphorylation | TGAYHGDSDLQLERI CCCCCCCCCCEEEEE | 44.83 | 18327897 | |
| 58 | Acetylation | YNEASGGKYVPRAVL EECCCCCCEECEEEE | 46.75 | 21791702 | |
| 115 | Phosphorylation | EGAELVDSVLDVVRK CHHHHHHHHHHHHHH | 19.66 | 18327897 | |
| 274 | Phosphorylation | MPGFAPLTSRGSQQY CCCCCCCCCCCCHHH | 18.47 | 19429919 | |
| 275 | Phosphorylation | PGFAPLTSRGSQQYR CCCCCCCCCCCHHHE | 42.18 | 19429919 | |
| 278 | Phosphorylation | APLTSRGSQQYRALT CCCCCCCCHHHEEEE | 17.01 | 19429919 | |
| 281 | Phosphorylation | TSRGSQQYRALTVPE CCCCCHHHEEEEHHH | 7.10 | 19429919 | |
| 312 | Phosphorylation | PRHGRYLTVAAIFRG CCCCCCHHHHHHHCC | 10.12 | 21082442 | |
| 322 | Phosphorylation | AIFRGRMSMKEVDEQ HHHCCCCCHHHHHHH | 25.91 | 21082442 | |
| 338 | Phosphorylation | LNIQNKNSSYFVEWI HHCCCCCCCHHEEEC | 28.20 | 21082442 | |
| 339 | Phosphorylation | NIQNKNSSYFVEWIP HCCCCCCCHHEEECC | 31.80 | 21082442 | |
| 366 | Phosphorylation | RGLKMSATFIGNSTA CCCCEEEEECCCHHH | 14.42 | 21082442 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TBB1_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TBB1_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TBB1_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CDKAL_DROME | CG6550 | physical | 22036573 | |
| C4AC1_DROME | Cyp4ac1 | physical | 22036573 | |
| RS27A_DROME | RpS27A | physical | 24292889 | |
| PFD3_DROME | mgr | physical | 22451918 | |
| PFD2_DROME | l(3)01239 | physical | 27025979 | |
| VHL_DROME | Vhl | physical | 20388653 | |
| VHL_DROME | Vhl | physical | 22451918 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-40 AND SER-339, AND MASSSPECTROMETRY. | |
