PFD2_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PFD2_DROME
• UniProt AC: Q9VTE5
• Protein Name: Probable prefoldin subunit 2 {ECO:0000312|FlyBase:FBgn0010741}
• Gene Name: Pfdn2 {ECO:0000312|FlyBase:FBgn0010741}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 143
• Protein Description: Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins (By similarity)..
• Protein Sequence: MSTESAKPALSQEAIVAQFQQLRNEQRNLVNSLNTLEMDLREHKTVIETLEAADPERKCFRQIGGVLCERTVKEVLPQLVENKDFIAKTIQMVTNDLSKKGSELNKFKEEHNIKIRGEHLVAEGAKGDDAEDKAENRNVLVFN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of PFD2_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PFD2_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PFD2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PFD2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PFD6_DROME	CG7770	physical	22036573
PFD3_DROME	mgr	physical	22036573
PFD5_DROME	CG7048	physical	22036573
PFD4_DROME	CG10635	physical	22036573
PFD3_DROME	mgr	genetic	27025979
APKC_DROME	aPKC	genetic	27025979
PFD3_DROME	mgr	physical	27025979
PFD5_DROME	CG7048	physical	27025979

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.