PFD5_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PFD5_DROME
• UniProt AC: Q9VCZ8
• Protein Name: Probable prefoldin subunit 5
• Gene Name: Pfdn5 {ECO:0000312|FlyBase:FBgn0038976}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 168
• Protein Description: Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins (By similarity)..
• Protein Sequence: MAATPSAPAKSEMIDLTKLSPEQLIQIKQEFEQEITNVQDSLSTLHGCQAKYAGSKEALGTFQPNWENRQILVPLTSSMYVPGRVKDLNRFVIDIGTGYYIEKDLEGSKDYFKRRVEYVQEQIEKIEKIHLQKTRFYNSVMSVLEMKQAAAAKLQSQQQSQPAVTQSS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
109	Acetylation	EKDLEGSKDYFKRRV ECCCCCCHHHHHHHH	68.27	21791702
128	Acetylation	EQIEKIEKIHLQKTR HHHHHHHHHHCCHHH	38.61	21791702
142	Phosphorylation	RFYNSVMSVLEMKQA HHHHHHHHHHHHHHH	22.76	21082442

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PFD5_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PFD5_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PFD5_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PFD6_DROME	CG7770	physical	14605208
PFD2_DROME	l(3)01239	physical	27025979

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.