PFD6_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PFD6_DROME
• UniProt AC: Q9VW56
• Protein Name: Probable prefoldin subunit 6
• Gene Name: Pfdn6 {ECO:0000312|FlyBase:FBgn0036918}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 125
• Protein Description: Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins (By similarity)..
• Protein Sequence: MDKKSAALYKKMQAEIESYQNLQKSCLKMVKQRAVLESQLNENKCVLDELNLLGPDNKVYKLFGPVLVKQELEESRQNVGKRIEYISKELKSSTDALENMEKDMLKHRESVAKYQQQCQVAAAMQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
88	Acetylation	KRIEYISKELKSSTD HHHHHHHHHHHHCHH	58.47	21791702

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PFD6_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PFD6_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PFD6_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PFD3_DROME	mgr	physical	22036573
PFD5_DROME	CG7048	physical	22036573

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.