UniProt ID | VHL_DROME | |
---|---|---|
UniProt AC | Q9V3C1 | |
Protein Name | Protein Vhl | |
Gene Name | Vhl {ECO:0000312|FlyBase:FBgn0041174} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 178 | |
Subcellular Localization | ||
Protein Description | Involved in development of tracheal vasculature. Probably involved in halting cell migration at the end of vascular tube outgrowth. Possesses E3 ubiquitin ligase activity when in complex with Elongin BC complex, Cul2 and Rox1a/Rbx1, and can target sima/Hif1a for ubiquitination. May play a critical role in promoting microtubule stabilization when tubulins are correctly folded by the prefoldin complex. If tubulin is incorrectly folded, may promote its degradation.. | |
Protein Sequence | MALQIAQNNRDGQQLVGADQGKVEVYVLFANTTYRTLDLYWVCERERENMYLTLKPFEEVRVNTFTTHSWLFRDYYTGERMHVRSQRIFQPIRVRVPKSQQSPDQLVDVRSEVLIHFPMRSLRENCLWLVARWLIRTSNAPRRIIHGYHIPSTLKQQLLSLLTCIESYSRVAGTRRRR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
102 | Phosphorylation | RVPKSQQSPDQLVDV ECCCCCCCCCCEEEC | 23.86 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VHL_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VHL_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VHL_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TRC8_DROME | Trc8 | physical | 12032852 | |
FBXW7_DROME | ago | genetic | 19285057 | |
FBXW7_DROME | ago | genetic | 23459416 | |
FGFR2_DROME | btl | genetic | 19285057 | |
SIMA_DROME | sima | genetic | 19285057 | |
TBB1_DROME | betaTub56D | physical | 22451918 | |
PFD3_DROME | mgr | physical | 22451918 | |
NDKA_DROME | awd | physical | 20516215 | |
NDKA_DROME | awd | physical | 24915993 | |
VHL_DROME | Vhl | physical | 22451918 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...