UniProt ID | NDKA_DROME | |
---|---|---|
UniProt AC | P08879 | |
Protein Name | Nucleoside diphosphate kinase | |
Gene Name | awd | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 153 | |
Subcellular Localization | Cytoplasm . Cytoplasm, cytoskeleton . Microtubule-associated. | |
Protein Description | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.. | |
Protein Sequence | MAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNEKELVTWTPAAKDWIYE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAANKERTF ------CCCCCCCEE | 21.53 | 12099695 | |
13 | Acetylation | ERTFIMVKPDGVQRG CCEEEEECCCCCCCH | 21.73 | 21791702 | |
24 | Acetylation | VQRGLVGKIIERFEQ CCCHHHHHHHHHHHH | 32.79 | 21791702 | |
35 | Acetylation | RFEQKGFKLVALKFT HHHHCCCEEEEEECH | 51.20 | 21791702 | |
45 | Phosphorylation | ALKFTWASKELLEKH EEECHHHCHHHHHHH | 20.44 | 19429919 | |
46 | Acetylation | LKFTWASKELLEKHY EECHHHCHHHHHHHC | 44.63 | 21791702 | |
51 | Acetylation | ASKELLEKHYADLSA HCHHHHHHHCCCCCC | 41.71 | 21791702 | |
95 | Phosphorylation | GRQMLGATNPADSLP HHHCCCCCCCHHCCC | 39.68 | 21082442 | |
121 | Phosphorylation | GRNIIHGSDAVESAE CCCEECCCHHHHHHH | 14.29 | 19429919 | |
126 | Phosphorylation | HGSDAVESAEKEIAL CCCHHHHHHHHHHHH | 34.82 | 7559441 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDKA_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDKA_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDKA_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Post-translational processing of Drosophila nucleoside diphosphatekinase."; Stenberg L.M., Stenflo J., Holmgren P., Brown M.A.; Biochem. Biophys. Res. Commun. 295:689-694(2002). Cited for: PROTEIN SEQUENCE OF 3-15; 33-35; 47-96 AND 147-153, MASS SPECTROMETRY,BLOCKAGE OF N-TERMINUS, AND ACETYLATION AT ALA-2. | |
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-126, AND MASSSPECTROMETRY. |