| UniProt ID | TRXR1_DROME | |
|---|---|---|
| UniProt AC | P91938 | |
| Protein Name | Thioredoxin reductase 1, mitochondrial | |
| Gene Name | Trxr-1 | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 596 | |
| Subcellular Localization |
Isoform B: Mitochondrion. Isoform A: Cytoplasm. |
|
| Protein Description | Thioredoxin system is a major player in glutathione metabolism, due to the demonstrated absence of a glutathione reductase. Functionally interacts with the Sod/Cat reactive oxidation species (ROS) defense system and thereby has a role in preadult development and life span. Lack of a glutathione reductase suggests antioxidant defense in Drosophila, and probably in related insects, differs fundamentally from that in other organisms.. | |
| Protein Sequence | MNLCNSRFSVTFVRQCSTILTSPSAGIIQNRGSLTTKVPHWISSSLSCAHHTFQRTMNLTGQRGSRDSTGATGGNAPAGSGAGAPPPFQHPHCDRAAMYAQPVRKMSTKGGSYDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDEKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEEAEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKDKIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSGLDPTPASCCS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 65 | Phosphorylation | NLTGQRGSRDSTGAT CCCCCCCCCCCCCCC | 34.79 | 21082442 | |
| 68 | Phosphorylation | GQRGSRDSTGATGGN CCCCCCCCCCCCCCC | 27.86 | 21082442 | |
| 69 | Phosphorylation | QRGSRDSTGATGGNA CCCCCCCCCCCCCCC | 34.82 | 18511481 | |
| 72 | Phosphorylation | SRDSTGATGGNAPAG CCCCCCCCCCCCCCC | 47.14 | 21082442 | |
| 99 | Phosphorylation | HCDRAAMYAQPVRKM CCCHHHHHHHCCCCC | 9.43 | 18281928 | |
| 288 | Ubiquitination | TSDDLFSLDREPGKT CCCCCCCCCCCCCCE | 5.88 | 31113955 | |
| 305 | Ubiquitination | VGAGYIGLECAGFLK ECCCCHHHHHHHHHC | 3.38 | 31113955 | |
| 322 | Ubiquitination | GYEPTVMVRSIVLRG CCCCEEEEEHHHHCC | 3.64 | 31113955 | |
| 393 | Ubiquitination | VLWAIGRKGLVDDLN HHHHHHCCCCCCCCC | 51.92 | 31113955 | |
| 455 | Phosphorylation | RLLARRLYGGSTQRM HHHHHHHHCCCCCCC | 20.03 | 25749252 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRXR1_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRXR1_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRXR1_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TNG2_DROME | Tango2 | physical | 22036573 | |
| THIO2_DROME | Trx-2 | physical | 22036573 | |
| TRXR2_DROME | Trxr-2 | physical | 22036573 | |
| SODC_DROME | Sod | genetic | 11525742 | |
| CATA_DROME | Cat | genetic | 11525742 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
