| UniProt ID | SODC_DROME | |
|---|---|---|
| UniProt AC | P61851 | |
| Protein Name | Superoxide dismutase [Cu-Zn] {ECO:0000303|PubMed:3110743} | |
| Gene Name | Sod1 {ECO:0000312|FlyBase:FBgn0003462} | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 153 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Destroys radicals which are normally produced within the cells and which are toxic to biological systems.. | |
| Protein Sequence | MVVKAVCVINGDAKGTVFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMSSGPHFNPYGKEHGAPVDENRHLGDLGNIEATGDCPTKVNITDSKITLFGADSIIGRTVVVHADADDLGQGGHELSKSTGNAGARIGCGVIGIAKV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 23 | Phosphorylation | TVFFEQESSGTPVKV EEEEEECCCCCEEEE | 33.49 | 22668510 | |
| 24 | Phosphorylation | VFFEQESSGTPVKVS EEEEECCCCCEEEEE | 46.03 | 22668510 | |
| 26 | Phosphorylation | FEQESSGTPVKVSGE EEECCCCCEEEEEEE | 27.19 | 22668510 | |
| 53 | Phosphorylation | VHEFGDNTNGCMSSG EEEECCCCCCCCCCC | 37.41 | 17372656 | |
| 59 | Phosphorylation | NTNGCMSSGPHFNPY CCCCCCCCCCCCCCC | 29.47 | 17372656 | |
| 104 | Phosphorylation | NITDSKITLFGADSI ECCCCCEEEEECCCC | 21.55 | 21082442 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SODC_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SODC_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SODC_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TREA_DROME | Treh | physical | 22036573 | |
| FKB12_DROME | FK506-bp2 | physical | 22036573 | |
| THIO2_DROME | Trx-2 | physical | 22036573 | |
| SH3BG_DROME | Sh3beta | physical | 22036573 | |
| TNG2_DROME | Tango2 | physical | 22036573 | |
| NLP_DROME | Nlp | physical | 22036573 | |
| CALR_DROME | Crc | physical | 22036573 | |
| ORN_DROME | CG10214 | physical | 22036573 | |
| PDI_DROME | Pdi | physical | 22036573 | |
| PPIA_DROME | Cyp1 | physical | 22036573 | |
| TRXR1_DROME | Trxr-1 | physical | 22036573 | |
| SSBP_DROME | mtSSB | physical | 22036573 | |
| NIF3L_DROME | CG4278 | physical | 22036573 | |
| RS21_DROME | RpS21 | physical | 22036573 | |
| TAF5_DROME | Taf5 | physical | 22036573 | |
| WWOX_DROME | Wwox | genetic | 21075834 | |
| SODM_DROME | Sod2 | genetic | 24656823 | |
| SODC_DROME | Sod | physical | 7567977 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "An integrated chemical, mass spectrometric and computational strategyfor (quantitative) phosphoproteomics: application to Drosophilamelanogaster Kc167 cells."; Bodenmiller B., Mueller L.N., Pedrioli P.G.A., Pflieger D.,Juenger M.A., Eng J.K., Aebersold R., Tao W.A.; Mol. Biosyst. 3:275-286(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-53 AND SER-59, AND MASSSPECTROMETRY. | |