| UniProt ID | NLP_DROME | |
|---|---|---|
| UniProt AC | Q27415 | |
| Protein Name | Nucleoplasmin-like protein | |
| Gene Name | Nlp | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 152 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Binds to core histones and functions in the ATP-facilitated assembly of approximately regularly spaced nucleosomal arrays. May participate in parallel with other histone-binding proteins such as NAP-1.; Isoform 2 is inactive for chromatin assembly. In vitro it appears to form a high molecular mass aggregate with the core histones.. | |
| Protein Sequence | MAEESFYGVTLTAESDSVTWDVDEDYARGQKLVIKQILLGAEAKENEFNVVEVNTPKDSVQIPIAVLKAGETRAVNPDVEFYESKVTFKLIKGSGPVYIHGHNIKDDVEVVDMEEDDEEDDVAEDEEDEHPKKRAKIENAADGKNAKNNKKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of NLP_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NLP_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NLP_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NLP_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SH3BG_DROME | Sh3beta | physical | 22036573 | |
| NACA_DROME | Nacalpha | physical | 22036573 | |
| INO1_DROME | Inos | physical | 22036573 | |
| YC17_DROME | CG16817 | physical | 22036573 | |
| EF1D_DROME | eEF1delta | physical | 22036573 | |
| THIO2_DROME | Trx-2 | physical | 22036573 | |
| HCD2_DROME | scu | physical | 22036573 | |
| TERA_DROME | TER94 | physical | 22036573 | |
| TCTP_DROME | Tctp | physical | 22036573 | |
| 1433E_DROME | 14-3-3epsilon | physical | 22036573 | |
| IF5A_DROME | eIF-5A | physical | 22036573 | |
| TNG2_DROME | Tango2 | physical | 22036573 | |
| TRXR1_DROME | Trxr-1 | physical | 22036573 | |
| THIO1_DROME | dhd | physical | 28031247 | |
| CID_DROME | cid | physical | 23562326 | |
| NLP_DROME | Nlp | physical | 9087911 | |
| MODU_DROME | mod | physical | 23562326 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
