THIO1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: THIO1_DROME
• UniProt AC: P47938
• Protein Name: Thioredoxin-1
• Gene Name: dhd
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 107
• Subcellular Localization: Nucleus .
• Protein Description: Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. As a reducing substrate of peroxiredoxin 1, thioredoxin 2 is preferred over thioredoxin 1. Required for female meiosis and early embryonic development..
• Protein Sequence: MASVRTMNDYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELTERYKVRSMPTFVFLRQNRRLASFAGADEHKLTNMMAKLVKA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of THIO1_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of THIO1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of THIO1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of THIO1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DCTN2_DROME	Dmn	physical	14605208
GRK_DROME	grk	physical	23213441

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.