UniProt ID | CID_DROME | |
---|---|---|
UniProt AC | Q9V6Q2 | |
Protein Name | Histone H3-like centromeric protein cid | |
Gene Name | cid | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 225 | |
Subcellular Localization | Nucleus. Chromosome, centromere, kinetochore. Localizes exclusively in the kinetochore domain of centromeres. Co-expressed with yemalpha. | |
Protein Description | Histone H3-like variant which exclusively replaces conventional H3 in the nucleosome core of centromeric chromatin at the inner plate of the kinetochore. Required for recruitment and assembly of kinetochore proteins, mitotic progression and chromosome segregation. May serve as an epigenetic mark that propagates centromere identity through replication and cell division.. | |
Protein Sequence | MPRHSRAKRAPRPSANNSKSPNDDDTAFRSPEPEDGTDYGLEFTTSQLTLQDNNRRSSTLRRDAGRRQPAARDSSTSGEEEDQENRYPTTRSPQTRRMTVQQESKTRAAGPVAAQNQTRRRKAANPMSRAKRMDREIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYLTQRLADSYMLTKHRNRVTLEVRDMALMAYICDRGRQF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | Phosphorylation | AKRAPRPSANNSKSP CCCCCCCCCCCCCCC | 44.93 | 22817900 | |
30 | Phosphorylation | DDDTAFRSPEPEDGT CCCCCCCCCCCCCCC | 27.45 | 22668510 | |
74 | Phosphorylation | RQPAARDSSTSGEEE CCCCCCCCCCCCCHH | 29.93 | 22817900 | |
75 | Phosphorylation | QPAARDSSTSGEEED CCCCCCCCCCCCHHH | 30.77 | 22817900 | |
76 | Phosphorylation | PAARDSSTSGEEEDQ CCCCCCCCCCCHHHH | 44.71 | 22817900 | |
77 | Phosphorylation | AARDSSTSGEEEDQE CCCCCCCCCCHHHHC | 46.27 | 22817900 | |
99 | Phosphorylation | SPQTRRMTVQQESKT CHHHCEEEECHHHHH | 17.22 | 21082442 | |
118 | Phosphorylation | PVAAQNQTRRRKAAN CHHHHHHHHHHHHCC | 33.42 | 25749252 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CID_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CID_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CID_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CAF1_DROME | Caf1 | physical | 16601098 | |
CID_DROME | cid | physical | 19047461 | |
SSRP1_DROME | Ssrp | physical | 26586808 | |
SPT16_DROME | dre4 | physical | 26586808 | |
CAF1_DROME | Caf1 | physical | 16775420 | |
CAF1_DROME | Caf1 | physical | 26586808 | |
NLP_DROME | Nlp | physical | 23562326 | |
MODU_DROME | mod | physical | 26586808 | |
MODU_DROME | mod | physical | 23562326 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-74; SER-75; THR-76 ANDSER-77, AND MASS SPECTROMETRY. |