UniProt ID | HCD2_DROME | |
---|---|---|
UniProt AC | O18404 | |
Protein Name | 3-hydroxyacyl-CoA dehydrogenase type-2 | |
Gene Name | scu | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 255 | |
Subcellular Localization | Mitochondrion. Localizes to the lipid droplet fraction in early embryos. | |
Protein Description | May function in mitochondrial tRNA maturation. Catalyzes the beta-oxidation at position 17 of androgens and estrogens, and has 3-alpha-hydroxysteroid dehydrogenase activity with androsterone. Catalyzes the third step in the beta-oxidation of fatty acids. Carries out oxidative conversions of 7-beta-hydroxylated bile acids. Also exhibits 20-beta-OH and 21-OH dehydrogenase activities with C21 steroids. Required for cell survival during embryonic development. May play a role in germline formation.. | |
Protein Sequence | MIKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGDKVVFVPVDVTSEKDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPGLFNTPMLAALPEKVRTFLAKSIPFPQRLGEPSEYAHLVQAIYENPLLNGEVIRIDGALRMMP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
46 | Acetylation | SKGNEVAKELGDKVV CCCHHHHHHHCCEEE | 59.66 | 21791702 | |
99 | Acetylation | VKTFNFNKNVAHRLE EEEECCCCCHHHHHH | 48.97 | 21791702 | |
213 | Acetylation | KVRTFLAKSIPFPQR HHHHHHHHCCCCCHH | 51.57 | 21791702 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HCD2_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HCD2_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HCD2_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SH3BG_DROME | Sh3beta | physical | 22036573 | |
THIO2_DROME | Trx-2 | physical | 22036573 | |
NACA_DROME | Nacalpha | physical | 22036573 | |
COG3_DROME | Cog3 | physical | 22036573 | |
INO1_DROME | Inos | physical | 22036573 | |
IF5A_DROME | eIF-5A | physical | 22036573 | |
PGK_DROME | Pgk | physical | 22036573 | |
MRRP1_DROME | CG5190 | physical | 27131785 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...