UniProt ID | FKB12_DROME | |
---|---|---|
UniProt AC | P48375 | |
Protein Name | 12 kDa FK506-binding protein | |
Gene Name | FK506-bp2 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 108 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Binds to ligand-free TGF beta type I receptor, from which it is released upon a ligand-induced, type II receptor mediated phosphorylation of the type I receptor. Binding is inhibitory to the signaling pathways of the TGF beta family ligands.. | |
Protein Sequence | MGVQVVPIAPGDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQLSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTFDVELLKVE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
45 | Acetylation | DSSRDRNKPFKFTIG CCCCCCCCCEEEEEC | 53.37 | 21791702 | |
48 | Acetylation | RDRNKPFKFTIGKGE CCCCCCEEEEECCCC | 50.56 | 21791702 | |
53 | Acetylation | PFKFTIGKGEVIRGW CEEEEECCCCEECCC | 48.31 | 21791702 | |
78 | Phosphorylation | QRAKLICSPDYAYGS CCEEEEECCCCCCCC | 17.51 | 25749252 | |
81 | Phosphorylation | KLICSPDYAYGSRGH EEEECCCCCCCCCCC | 12.71 | 21082442 | |
85 | Phosphorylation | SPDYAYGSRGHPGVI CCCCCCCCCCCCCCC | 23.55 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FKB12_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FKB12_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FKB12_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PAN3_DROME | CG11486 | physical | 14605208 | |
ENA_DROME | ena | physical | 14605208 | |
OR9A_DROME | Or9a | physical | 14605208 | |
TITIN_DROME | sls | physical | 14605208 | |
VINC_DROME | Vinc | physical | 14605208 | |
FLNA_DROME | cher | physical | 14605208 | |
CSW_DROME | csw | physical | 14605208 | |
CP312_DROME | Cyp312a1 | physical | 14605208 | |
RL22_DROME | RpL22 | physical | 14605208 | |
PSA4_DROME | Prosalpha3 | physical | 14605208 | |
NLP_DROME | Nlp | physical | 22036573 | |
PDI_DROME | Pdi | physical | 22036573 | |
SH3BG_DROME | Sh3beta | physical | 22036573 | |
THIO2_DROME | Trx-2 | physical | 22036573 | |
DOD_DROME | dod | physical | 22036573 | |
INO1_DROME | Inos | physical | 22036573 | |
CP2B_DROME | Capa | physical | 22036573 | |
HCD2_DROME | scu | physical | 22036573 | |
NACA_DROME | Nacalpha | physical | 22036573 | |
YC17_DROME | CG16817 | physical | 22036573 | |
RS21_DROME | RpS21 | physical | 22036573 | |
TCP4_DROME | Ssb-c31a | physical | 22036573 | |
BTHD_DROME | BthD | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...