TCP4_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TCP4_DROME
• UniProt AC: Q9VLR5
• Protein Name: RNA polymerase II transcriptional coactivator
• Gene Name: Ssb-c31a
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 110
• Subcellular Localization: Nucleus .
• Protein Description: General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. Binds single-stranded DNA (By similarity). Binds specifically to the NssBF element, a short nucleotide sequence of the 1731 retrotransposon, to repress promoter activity..
• Protein Sequence: MPKTKKKDSSSDSDSGPDDRIKPASKKAKESDAPNSDPKDSGENGATSWTLEGLRQVRINEFRGRKSVDIREFYDKGGQILPGKKGISLSLIQWKKLLEVAEEVTRAIEN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
9	Phosphorylation	PKTKKKDSSSDSDSG CCCCCCCCCCCCCCC	40.39	19429919
10	Phosphorylation	KTKKKDSSSDSDSGP CCCCCCCCCCCCCCC	48.58	19429919
11	Phosphorylation	TKKKDSSSDSDSGPD CCCCCCCCCCCCCCC	45.12	19429919
13	Phosphorylation	KKDSSSDSDSGPDDR CCCCCCCCCCCCCHH	35.31	19429919
15	Phosphorylation	DSSSDSDSGPDDRIK CCCCCCCCCCCHHCC	57.06	19429919
31	Phosphorylation	ASKKAKESDAPNSDP HHHHHHHCCCCCCCC	38.06	21082442
36	Phosphorylation	KESDAPNSDPKDSGE HHCCCCCCCCCCCCC	54.98	22668510
67	Phosphorylation	NEFRGRKSVDIREFY EECCCCCCCCHHHHH	24.54	19429919
76	Acetylation	DIREFYDKGGQILPG CHHHHHHCCCCCCCC	54.27	21791702
88	Phosphorylation	LPGKKGISLSLIQWK CCCCCCEEEEHHCHH	22.15	21082442

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TCP4_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TCP4_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TCP4_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DDX41_DROME	abs	physical	22036573
RU17_DROME	snRNP-U1-70K	physical	22036573
PREP_DROME	CG3107	physical	22036573
U430_DROME	CG31712	physical	22036573
PUF68_DROME	pUf68	physical	22036573
NKAP_DROME	CG6066	physical	22036573

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.