UniProt ID | CP2B_DROME | |
---|---|---|
UniProt AC | Q9NIP6 | |
Protein Name | Cardio acceleratory peptide 2b | |
Gene Name | Capa | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 151 | |
Subcellular Localization | Secreted . Released from the neuroendocrine cells into the hemolymph. | |
Protein Description | CAP-1 and CAP-2, but not CAP-3 are ligands for the Capa receptor. [PubMed: 12177421] | |
Protein Sequence | MKSMLVHIVLVIFIIAEFSTAETDHDKNRRGANMGLYAFPRVGRSDPSLANSLRDGLEAGVLDGIYGDASQEDYNEADFQKKASGLVAFPRVGRGDAELRKWAHLLALQQVLDKRTGPSASSGLWFGPRLGKRSVDAKSFADISKGQKELN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
42 | Valine amide | GLYAFPRVGRSDPSL CEEECCCCCCCCHHH | 8.33 | - | |
42 | Amidation | GLYAFPRVGRSDPSL CEEECCCCCCCCHHH | 8.33 | 12171930 | |
84 | Phosphorylation | ADFQKKASGLVAFPR HHHHHHHCCCEEECC | 41.35 | 22817900 | |
92 | Valine amide | GLVAFPRVGRGDAEL CCEEECCCCCCHHHH | 6.62 | - | |
92 | Amidation | GLVAFPRVGRGDAEL CCEEECCCCCCHHHH | 6.62 | 12171930 | |
130 | Leucine amide | GLWFGPRLGKRSVDA CCCCCCCCCCCCCCH | 12.19 | - | |
130 | Amidation | GLWFGPRLGKRSVDA CCCCCCCCCCCCCCH | 12.19 | 12171930 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CP2B_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CP2B_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CP2B_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...