UniProt ID | DOD_DROME | |
---|---|---|
UniProt AC | P54353 | |
Protein Name | Putative peptidyl-prolyl cis-trans isomerase dodo | |
Gene Name | dod | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 166 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MPDAEQLPDGWEKRTSRSTGMSYYLNMYTKESQWDQPTEPAKKAGGGSAGGGDAPDEVHCLHLLVKHKGSRRPSSWREANITRTKEEAQLLLEVYRNKIVQQEATFDELARSYSDCSSAKRGGDLGKFGRGQMQAAFEDAAFKLNVNQLSGIVDSDSGLHIILRKA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
18 | Phosphorylation | WEKRTSRSTGMSYYL CHHHCCCCCCCHHHH | 29.13 | 19429919 | |
19 | Phosphorylation | EKRTSRSTGMSYYLN HHHCCCCCCCHHHHH | 35.47 | 19429919 | |
48 | Phosphorylation | AKKAGGGSAGGGDAP CHHCCCCCCCCCCCC | 27.32 | 19429919 | |
155 | Phosphorylation | QLSGIVDSDSGLHII HHCCCCCCCCCEEEE | 23.84 | 23607784 | |
157 | Phosphorylation | SGIVDSDSGLHIILR CCCCCCCCCEEEEEE | 47.40 | 23607784 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DOD_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DOD_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DOD_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FTZ_DROME | ftz | physical | 14605208 | |
EXD_DROME | exd | physical | 14605208 | |
SH3BG_DROME | Sh3beta | physical | 22036573 | |
NLP_DROME | Nlp | physical | 22036573 | |
INO1_DROME | Inos | physical | 22036573 | |
OB56H_DROME | Obp56h | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...