DOD_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DOD_DROME
• UniProt AC: P54353
• Protein Name: Putative peptidyl-prolyl cis-trans isomerase dodo
• Gene Name: dod
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 166
• Protein Sequence: MPDAEQLPDGWEKRTSRSTGMSYYLNMYTKESQWDQPTEPAKKAGGGSAGGGDAPDEVHCLHLLVKHKGSRRPSSWREANITRTKEEAQLLLEVYRNKIVQQEATFDELARSYSDCSSAKRGGDLGKFGRGQMQAAFEDAAFKLNVNQLSGIVDSDSGLHIILRKA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
18	Phosphorylation	WEKRTSRSTGMSYYL CHHHCCCCCCCHHHH	29.13	19429919
19	Phosphorylation	EKRTSRSTGMSYYLN HHHCCCCCCCHHHHH	35.47	19429919
48	Phosphorylation	AKKAGGGSAGGGDAP CHHCCCCCCCCCCCC	27.32	19429919
155	Phosphorylation	QLSGIVDSDSGLHII HHCCCCCCCCCEEEE	23.84	23607784
157	Phosphorylation	SGIVDSDSGLHIILR CCCCCCCCCEEEEEE	47.40	23607784

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DOD_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DOD_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DOD_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FTZ_DROME	ftz	physical	14605208
EXD_DROME	exd	physical	14605208
SH3BG_DROME	Sh3beta	physical	22036573
NLP_DROME	Nlp	physical	22036573
INO1_DROME	Inos	physical	22036573
OB56H_DROME	Obp56h	physical	22036573

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.