UniProt ID | EXD_DROME | |
---|---|---|
UniProt AC | P40427 | |
Protein Name | Homeobox protein extradenticle | |
Gene Name | exd | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 376 | |
Subcellular Localization | Nucleus . Nuclear translocation requires interaction with hth. | |
Protein Description | Transcription factor which acts with the selector homeodomain proteins altering the regulation of downstream target genes such as wingless (wg), teashirt (tsh) and decapentaplegic (dpp), thus affecting segmental identity. Delimits the eye field and prevent inappropriate eye development. Required for proper localization of chordotonal organs within the peripheral nervous system.. | |
Protein Sequence | MEDPNRMLAHTGGMMAPQGYGLSGQDDGQNAGSENEVRKQKDIGEILQQIMSISEQSLDEAQARKHTLNCHRMKPALFSVLCEIKEKTVLSIRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKGGGGAAAASAAAASQGGSLSIDGADNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGASPYSMAGPPSGTTTPMMSPAPPQDSMGYPMGSGGYDQQQPYDNSMGGYDPNLHQDLSP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
79 | Phosphorylation | RMKPALFSVLCEIKE HHCHHHHHHHHHHHH | 18.28 | 21082442 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EXD_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EXD_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EXD_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TSH_DROME | tsh | physical | 12231630 | |
LAB_DROME | lab | physical | 10529430 | |
LAB_DROME | lab | physical | 22824425 | |
LAB_DROME | lab | physical | 9405369 | |
SCR_DROME | Scr | physical | 22564794 | |
ANTP_DROME | Antp | physical | 10398683 | |
HTH_DROME | hth | physical | 25242320 | |
HTH_DROME | hth | physical | 10529430 | |
HTH_DROME | hth | physical | 22824425 | |
HTH_DROME | hth | physical | 22975331 | |
HTH_DROME | hth | physical | 21276241 | |
UBX_DROME | Ubx | physical | 10067897 | |
UBX_DROME | Ubx | physical | 10398683 | |
UBX_DROME | Ubx | physical | 20038634 | |
UBX_DROME | Ubx | physical | 22975331 | |
UBX_DROME | Ubx | physical | 7915199 | |
UBX_DROME | Ubx | physical | 7846045 | |
ABDA_DROME | abd-A | physical | 7846045 | |
PAX6_DROME | ey | physical | 12231630 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...