dbPTM

ANTP_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ANTP_DROME
UniProt AC	P02833
Protein Name	Homeotic protein antennapedia
Gene Name	Antp
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	378
Subcellular Localization	Nucleus .
Protein Description	Sequence-specific transcription factor which is part of a developmental regulatory system that regulates segmental identity in the mesothorax. Provides cells with specific positional identities on the anterior-posterior axis..
Protein Sequence	MTMSTNNCESMTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNANHQGNMPYPRFPPYDRMPYYNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQLQQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEITPPNSPQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of ANTP_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ANTP_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ANTP_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ANTP_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BAP60_DROME	Bap60	genetic	16083904
EXD_DROME	exd	genetic	18367556
CCNE_DROME	CycE	genetic	11546747
TSH_DROME	tsh	genetic	27747411
PCL_DROME	Pcl	genetic	6813190
MED19_DROME	MED19	genetic	24786462
PC_DROME	Pc	genetic	11139505
PC_DROME	Pc	genetic	14196019
HMPB_DROME	pb	genetic	16094438
SCR_DROME	Scr	genetic	3141923
HTH_DROME	hth	genetic	10395787
UBX_DROME	Ubx	genetic	14196019
UBX_DROME	Ubx	genetic	10359793
OSA_DROME	osa	genetic	9895321
OSA_DROME	osa	genetic	16299391
ASH2_DROME	ash2	genetic	8889525
CI_DROME	ci	genetic	18367556
PAX6_DROME	ey	genetic	11179224
PAX6_DROME	ey	genetic	18755899
SPEN_DROME	spen	genetic	10556062
HMG2_DROME	Dsp1	genetic	11139505
MAD_DROME	Mad	physical	25869471
TF2B_DROME	TfIIB	physical	25869471
SALM_DROME	salm	physical	25869471
SUH_DROME	Su(H)	physical	25869471
TSH_DROME	tsh	physical	25869471
MEF2_DROME	Mef2	physical	25869471
EVE_DROME	eve	physical	25869471
MAM_DROME	mam	physical	25869471
TWIST_DROME	twi	physical	25869471
DLL_DROME	Dll	physical	25869471
KRUP_DROME	Kr	physical	25869471
FOXF_DROME	bin	physical	25869471
MED19_DROME	MED19	physical	24786462
7UP1_DROME	svp	physical	25869471
7UP2_DROME	svp	physical	25869471
SRP_DROME	srp	physical	25869471
BAGP_DROME	bap	physical	25869471
SLOU_DROME	slou	physical	25869471
PNT1_DROME	pnt	physical	25869471
PNT2_DROME	pnt	physical	25869471
MYOD_DROME	nau	physical	25869471
PNR_DROME	pnr	physical	25869471
COLL_DROME	kn	physical	25869471

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ANTP_DROME

Related Literatures of Post-Translational Modification