UniProt ID | MAD_DROME | |
---|---|---|
UniProt AC | P42003 | |
Protein Name | Protein mothers against dpp | |
Gene Name | Mad | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 455 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Required for the function of decapentaplegic. May play an important role in mediating Dpp signaling. Involved in the BMP signaling pathway.. | |
Protein Sequence | MDTDDVESNTSSAMSTLGSLFSFTSPAVKKLLGWKQGDEEEKWAEKAVDSLVKKLKKRKGAIEELERALSCPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLELCQYPFSAKQKEVCINPYHYKRVESPVLPPVLVPRHSEFAPGHSMLQFNHVAEPSMPHNVSYSNSGFNSHSLSTSNTSVGSPSSVNSNPNSPYDSLAGTPPPAYSPSEDGNSNNPNDGGQLLDAQMGDVAQVSYSEPAFWASIAYYELNCRVGEVFHCNNNSVIVDGFTNPSNNSDRCCLGQLSNVNRNSTIENTRRHIGKGVHLYYVTGEVYAECLSDSAIFVQSRNCNYHHGFHPSTVCKIPPGCSLKIFNNQEFAQLLSQSVNNGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNAISSVS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
25 | Phosphorylation | GSLFSFTSPAVKKLL HHHHHCCCHHHHHHH | 14.62 | 17507407 | |
453 | Phosphorylation | SPHNAISSVS----- CCCHHHCCCC----- | 21.92 | 18327897 | |
455 | Phosphorylation | HNAISSVS------- CHHHCCCC------- | 36.13 | 18327897 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MAD_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MAD_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MAD_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NUMB_DROME | numb | physical | 14605208 | |
CPN_DROME | Cpn | physical | 14605208 | |
UBCD2_DROME | UbcD2 | physical | 14605208 | |
BCD_DROME | bcd | physical | 15575970 | |
2ABA_DROME | tws | physical | 15575970 | |
NPL4_DROME | Npl4 | physical | 15575970 | |
DAN_DROME | dan | physical | 15575970 | |
COG5_DROME | fws | physical | 15575970 | |
BOWEL_DROME | bowl | physical | 15575970 | |
MED15_DROME | MED15 | physical | 15575970 | |
PANG1_DROME | pan | physical | 15575970 | |
PANG2_DROME | pan | physical | 15575970 | |
TAMO_DROME | tamo | physical | 15575970 | |
SUDX_DROME | Su(dx) | physical | 15575970 | |
VPS18_DROME | dor | physical | 15575970 | |
SMUF1_DROME | lack | physical | 15575970 | |
Y3427_DROME | CG43427 | physical | 15575970 | |
YAP1_DROME | yki | physical | 19914168 | |
EYA_DROME | eya | genetic | 10683184 | |
WNTG_DROME | wg | genetic | 21990430 | |
YAP1_DROME | yki | genetic | 21238929 | |
INHB_DROME | Actbeta | genetic | 18820452 | |
ERKA_DROME | rl | genetic | 17507407 | |
ARM_DROME | arm | physical | 21990430 | |
CNEP1_DROME | Dd | physical | 27578171 | |
MAD_DROME | Mad | physical | 9693372 | |
MAD_DROME | Mad | physical | 19557331 | |
FOXF_DROME | bin | physical | 23935523 | |
PANG1_DROME | pan | physical | 21990430 | |
PANG2_DROME | pan | physical | 21990430 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-453 AND SER-455, ANDMASS SPECTROMETRY. | |
"Drosophila Nemo antagonizes BMP signaling by phosphorylation of Madand inhibition of its nuclear accumulation."; Zeng Y.A., Rahnama M., Wang S., Sosu-Sedzorme W., Verheyen E.M.; Development 134:2061-2071(2007). Cited for: FUNCTION, SUBCELLULAR LOCATION, AND PHOSPHORYLATION AT SER-25. | |
"DSmurf selectively degrades decapentaplegic-activated MAD, and itsoverexpression disrupts imaginal disc development."; Liang Y.-Y., Lin X., Liang M., Brunicardi F.C., ten Dijke P., Chen Z.,Choi K.-W., Feng X.-H.; J. Biol. Chem. 278:26307-26310(2003). Cited for: INTERACTION WITH LACK, PHOSPHORYLATION AT SER-453 AND SER-455,MUTAGENESIS OF SER-453 AND SER-455, AND UBIQUITINATION. |