dbPTM

UBCD2_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	UBCD2_DROME
UniProt AC	P52485
Protein Name	Ubiquitin-conjugating enzyme E2-24 kDa
Gene Name	Ubc2 {ECO:0000312\|FlyBase:FBgn0015320}
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	232
Subcellular Localization
Protein Description	Catalyzes the covalent attachment of ubiquitin to other proteins..
Protein Sequence	MSSTPAAGSAAEVATSSATSNAPSAPSTTASNVSNTSQPTTAGTPQARGGRGSNANGGASGSNAGGGDEPRKEAKTTPRISRALGTSAKRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQNREEHDRIARLWTKRYAT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
44	Phosphorylation	SQPTTAGTPQARGGR CCCCCCCCCCCCCCC	15.12	28490779
53	Phosphorylation	QARGGRGSNANGGAS CCCCCCCCCCCCCCC	31.26	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of UBCD2_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of UBCD2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of UBCD2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
BX42_DROME	Bx42	physical	14605208

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of UBCD2_DROME

Related Literatures of Post-Translational Modification