dbPTM

2ABA_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	2ABA_DROME
UniProt AC	P36872
Protein Name	Protein phosphatase PP2A 55 kDa regulatory subunit
Gene Name	tws
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	499
Subcellular Localization
Protein Description	Could perform a substrate recognition function or could be responsible for targeting the enzyme complex to the appropriate subcellular compartment..
Protein Sequence	MGRWGRQSPVLEPPDPQMQTTPPPPTLPPRTFMRQSSITKIGNMLNTAININGAKKPASNGEASWCFSQIKGALDDDVTDADIISCVEFNHDGELLATGDKGGRVVIFQRDPASKAANPRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLQQKNPVHFLLSTNDKTVKLWKVSERDKSFGGYNTKEENGLIRDPQNVTALRVPSVKQIPLLVEASPRRTFANAHTYHINSISVNSDQETFLSADDLRINLWHLEVVNQSYNIVDIKPTNMEELTEVITAAEFHPTECNVFVYSSSKGTIRLCDMRSAALCDRHSKQFEEPENPTNRSFFSEIISSISDVKLSNSGRYMISRDYLSIKVWDLHMETKPIETYPVHEYLRAKLCSLYENDCIFDKFECCWNGKDSSIMTGSYNNFFRVFDRNSKKDVTLEASRDIIKPKTVLKPRKVCTGGKRKKDEISVDCLDFNKKILHTAWHPEENIIAVAATNNLFIFQDKF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of 2ABA_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of 2ABA_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of 2ABA_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of 2ABA_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARM_DROME	arm	genetic	14973271
SODM_DROME	Sod2	genetic	21471219
APKC_DROME	aPKC	genetic	19374896
APKC_DROME	aPKC	physical	19374896

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of 2ABA_DROME

Related Literatures of Post-Translational Modification