UniProt ID | SODM_DROME | |
---|---|---|
UniProt AC | Q00637 | |
Protein Name | Superoxide dismutase [Mn], mitochondrial | |
Gene Name | Sod2 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 217 | |
Subcellular Localization | Mitochondrion matrix. | |
Protein Description | Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.. | |
Protein Sequence | MFVARKISPNCKPGVRGKHTLPKLPYDYAALEPIICREIMELHHQKHHQTYVNNLNAAEEQLEEAKSKSDTTKLIQLAPALRFNGGGHINHTIFWQNLSPNKTQPSDDLKKAIESQWKSLEEFKKELTTLTVAVQGSGWGWLGFNKKSGKLQLAALPNQDPLEASTGLIPLFGIDVWEHAYYLQYKNVRPSYVEAIWDIANWDDISCRFQEAKKLGC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
73 | Acetylation | KSKSDTTKLIQLAPA HCCCCHHHHHHHHHH | 45.76 | 21791702 | |
118 | Acetylation | KAIESQWKSLEEFKK HHHHHHHHCHHHHHH | 37.21 | 21791702 | |
124 | Acetylation | WKSLEEFKKELTTLT HHCHHHHHHHHHHEE | 48.93 | 21791702 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SODM_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SODM_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SODM_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UCHL_DROME | Uch | physical | 22036573 | |
OGG1_DROME | Ogg1 | genetic | 24516391 | |
SODC_DROME | Sod | genetic | 24656823 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...